KEGG   Marinobacter sp. CP1: ACP86_11225Help
Entry
ACP86_11225       CDS       T04052                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K06857  tungstate transport system ATP-binding protein [EC:7.3.2.6]
Organism
mari  Marinobacter sp. CP1
Pathway
mari02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mari00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ACP86_11225
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mari02000]
    ACP86_11225
Enzymes [BR:mari01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.6  ABC-type tungstate transporter
     ACP86_11225
Transporters [BR:mari02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Tungstate transporter
    ACP86_11225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_16 AAA_29 AAA_27 AAA_30 AAA_23 SbcCD_C
Motif
Other DBs
NCBI-ProteinID: AKV96692
UniProt: A0A0K1UAB4
LinkDB All DBs
Position
complement(2430385..2431128)
Genome map
AA seq 247 aa AA seqDB search
MTSLNVPLNNSIELSAPPSLRFENVEFNPFGHRLFGPCSFTLDGPGPTLVMGPNGAGKSL
MLRLAHGLLTPTEGAVSWSGASAPRQAMVFQTPILLRRSALANLRHALAVNNVPRRLRTE
LALEALARFGLSSCADTPARVLSGGEKQRLALARAWSLSPAVLFLDEPTSALDPAAIKAV
EAAVQEFHKQGTRVVMTTHDLHQARRLAGDVLFLSEGKVQEHTSADIFFRAPVSRHAQAY
LNGELVA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgacttcgttgaacgtgcctctcaacaattcgatcgagctcagcgcacccccttcgctg
cgttttgaaaacgttgagttcaaccctttcgggcaccggctctttggtccctgctcgttc
acgctcgatggccccggccccacgctggtaatgggccccaatggcgccggcaagagcctc
atgctgcgactggcgcacggactgctcacaccgacggagggcgccgtgagctggtcaggc
gccagcgcgccccgccaggccatggttttccagacgccgatccttttgcgccgttcggcg
ctggccaacctcaggcacgcactggcagtcaacaacgtgccacgcaggctgcgaacagaa
ctggcactcgaagccctggcgcggttcggtctgtcctcctgcgccgacacgcccgcccgg
gtgctgtccggtggtgaaaaacaacgactggcactggcacgagcctggtcgctttcaccg
gcagtgctgtttctggatgaacccacctccgcactggatccggctgcgatcaaggccgtg
gaagccgccgtgcaggaatttcacaagcagggtacccgcgttgtaatgaccacgcacgat
ctccaccaggcacgtcgactggccggcgacgtcctgttcctttctgaaggcaaagtacag
gagcacacatccgcagatatctttttccgagcccctgtctcgcgccacgcacaagcctac
ctcaacggcgagctcgtagcctga

DBGET integrated database retrieval system