KEGG   Marinobacter sp. CP1: ACP86_11840Help
Entry
ACP86_11840       CDS       T04052                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K17760  quinohemoprotein ethanol dehydrogenase [EC:1.1.9.1]
Organism
mari  Marinobacter sp. CP1
Brite
KEGG Orthology (KO) [BR:mari00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ACP86_11840
Enzymes [BR:mari01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.9  With a copper protein as acceptor
    1.1.9.1  alcohol dehydrogenase (azurin)
     ACP86_11840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ PQQ_2 PQQ_3 Cytochrome_CBB3 Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: AKV96797
UniProt: A0A0K1UAM9
LinkDB All DBs
Position
2567713..2569824
Genome map
AA seq 703 aa AA seqDB search
MTLINKYPKTWLVKKALSTSLVSCLVLGASNVSAADQVNENYIIENAKTGKDWPTHGFDH
AETRFSPLSKISSDNVENLGLAWSYNLASIRGVEATPIVVDGVMYVTASWSVVHALNAKT
GEKLWTYDPEVPGEAGAWGCCDVVNRGVALHEGNVYVASYDGRLIAINAKNGKKVWEKNT
LPDNDMSYTITGAPRVVNGNVIIGNGGADLGVRGYITAYDAKTGQQKWRWYTVPGDPNEP
FENEAMERAAKTWDPSGKYWETGGGGTVWDSIVFDPDLNLLYIGTGNGSPWSHKKRSPEG
GDNLYLASIVALNPDTGEYVWHYQATPGDNWDYTSTQDMILTDLMIDGEMRKVIMQAPKN
GFFFVLDRTDGEFISAENYVDVNWAEGYDSDGRPIEVAAARNMDEPFDIIPGPFGGHNWH
SMSFNPQTGLAYFPSQHIPITMVEDPTWEGVDSNEPGQPMSGVGWNTAFRLNAAPPSSKP
FGRLTAWNPVTQKEAWRYEHVSPWNGGTLSTAGDLVFQGTADARFMAFNAQTGQPLWESP
MGTGVIAAPVTYEVDGTQYVSIAAGWGGVYGKSQRASDLKTAGTVYTFALNGDAEMPEFT
KYQLNSLISGVEYNPEFVEEGTALYVSNCVFCHGVPGVDKGGNIPNLGYSQKSVIENLDV
MVFEGPLLSSGMPHFTGKLSEMDVEKIKAFIQGTADAIRPKTQ
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgataaataagtaccctaaaacctggctcgtgaagaaagcattatctacatca
ttggtttcttgtttagtactcggagctagtaatgttagcgccgctgatcaggttaacgaa
aactatatcattgaaaatgccaaaacaggtaaagactggcccacccatggtttcgatcac
gcagaaacccgctttagtcctctttcaaaaatttcatctgataacgtcgaaaaccttggg
cttgcttggtcctataacttggcgtccatccgtggtgtcgaggctacgcctatcgttgtt
gatggcgtgatgtacgtcactgcctcttggagcgttgtacacgcactcaatgcaaaaacc
ggcgagaaactttggacttacgatccagaagtgccaggtgaagccggtgcttgggggtgt
tgtgacgttgtgaatcgtggagtagcgcttcatgagggcaacgtctacgttgcatcttac
gatggccgactgattgctattaatgcaaaaaatggcaaaaaggtctgggaaaaaaatact
ctgcccgataatgacatgagttacacgataaccggggcacctagagtagttaacggcaac
gtcatcataggaaatggtggcgccgatcttggggttaggggttacattactgcgtacgac
gccaaaaccggtcaacaaaaatggcgctggtataccgtaccaggagacccaaacgagccg
tttgaaaacgaagctatggagagagccgccaaaacctgggacccgagcgggaaatactgg
gaaactggtggcggtggtacagtgtgggactctatcgtttttgatccggacctcaatctc
ttgtacatcggtacaggcaacggatctccgtggtcccataaaaagcgtagcccagagggg
ggcgacaacctttacttggcttctatcgtagcactcaacccggatactggtgagtatgtg
tggcattaccaggctacacctggtgataactgggactatacctctacacaggacatgatt
cttaccgatctcatgattgatggtgagatgcgaaaagttatcatgcaagctcctaaaaac
ggcttcttttttgttctcgaccggaccgatggagagttcatctccgccgaaaattacgtc
gacgtcaactgggccgaaggatacgacagcgatggtcgccccattgaagttgctgccgcg
cgaaacatggatgagcctttcgacatcattccaggacccttcggcgggcataattggcac
tcaatgtcttttaaccctcaaacagggctagcttatttcccgtctcagcacattcccatc
acgatggtcgaagacccgacctgggagggcgtggacagcaatgagcccggacaaccaatg
agtggcgttggttggaatacagcatttaggctcaacgcagcgccaccctcaagcaaaccg
tttggacgtctaactgcctggaatcccgttactcagaaggaagcttggcgctatgagcat
gtctctccatggaacggcggcactctctcaacggctggcgatctggtgtttcaaggaact
gcagatgcccgatttatggcattcaacgcacaaacaggccagcctctctgggaatcccca
atgggtaccggcgttatcgccgcaccggtcacttacgaagtcgatggcactcaatacgtg
tccattgcagcgggctggggaggagtttacgggaaatctcagagagcttctgatctgaaa
accgccggcaccgtttatacatttgccctgaacggagatgccgagatgcctgagttcacc
aaataccagctgaactctcttatatcgggtgttgagtacaatccggaattcgtcgaagaa
ggcactgctctttacgtcagtaattgcgtgttttgtcatggtgtgcccggtgtagacaag
ggcggcaatattccaaatttaggttattcccaaaagtcagtcattgaaaacctggatgtt
atggtgtttgagggccccctgctatctagtggaatgcctcatttcaccggaaaactgagc
gaaatggatgtcgagaaaataaaggcattcatccagggaactgctgacgctattcgcccc
aagacacagtga

DBGET integrated database retrieval system