KEGG   Marinobacter sp. CP1: ACP86_14855
Entry
ACP86_14855       CDS       T04052                                 

Definition
(GenBank) histidine kinase
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
mari  Marinobacter sp. CP1
Pathway
mari02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mari00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ACP86_14855
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mari01001]
    ACP86_14855
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mari02022]
    ACP86_14855
Enzymes [BR:mari01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ACP86_14855
Protein kinases [BR:mari01001]
 Histidine kinases
  OmpR family
   ACP86_14855
Two-component system [BR:mari02022]
 OmpR family
  RstB-RstA
   ACP86_14855
SSDB
Motif
Pfam: HATPase_c HisKA HATPase_c_3 SCAB_CC HATPase_c_2 HAMP
Other DBs
NCBI-ProteinID: AKV98763
UniProt: A0A0K1UG49
LinkDB
Position
3220166..3221740
AA seq 524 aa
MPLKFFLKLYARLAGLTALVVFLCVLLFTGINSVRSQFWHERFPEPLMRWLAAAPAPLQQ
YHWLSSAVDLRMGAASRFNLSPVALERLGYGQVVGIDSDVGYRVLVTGLSGEILQLRLNE
PYRDVSETIGLIFRWHLDSASADDRLNVASQMARSLNVEVQTLDDADLLPDSDVLDQVAE
RGLAFYTDESDGCGRVIVQLSDGELYRIDMPAGFDPWAWPVVLLLVLVLGGVLAVAVFLA
LREVDSNLRTVESVAVRIARGEMSARVQAGEGTLVTRLASSFNGMAEHIQRLVQVQREMI
HAVSHELRTPVARIRFGVQMIEDCQDESALQRQLDGIDGDIQELDELIDEILTYARLEQG
GPVFSLQETSVTDIVRQVVSEQQMVRPELSIEGNIDEVSERWALSDIEPRYLHRAIQNLV
GNAGRYAAGKVLVSCHFDEDNCRVDVEDDGPGIPEEDWEKVFTAFARLDDSRTRTSGGYG
LGLSIVRRILYWHGGHAFVSRSDTLGGAKFSLVWPRKKPVDSIV
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgcccctgaagttcttcctcaagctttatgcccgccttgccggcctgaccgcgctggtt
gtttttttatgtgtcctgctgttcaccgggatcaactcggtgcgctcccaattctggcat
gaacgcttccccgagccactgatgcgctggctggctgcggccccggcaccattacagcaa
taccactggctgagttcggcggttgatcttcgcatgggggctgcttcccgtttcaacctg
tcaccggtggctctggagcgacttggctacggccaggtggttggcatcgacagtgacgta
gggtatcgggttctggtaaccggactgagcggagaaatcctgcagctgcgtctgaacgag
ccctaccgggatgtgtcagaaaccattgggttgattttccggtggcatcttgattcagcc
tctgcggatgaccgtctcaatgttgcctcgcaaatggcccgttctctcaatgtcgaagtg
cagaccctggacgacgccgacctgctgccggactctgacgttctggaccaggtcgccgag
cggggccttgccttctacaccgacgaatcagacggttgcggacgggtgatcgttcagcta
tccgacggtgagttgtaccggattgacatgcccgcggggtttgatccctgggcctggccg
gttgtcctgctgctggtcctggtgcttggcggggttttggccgttgccgttttcctcgcg
ctccgggaagtggacagtaatctcagaaccgttgagtcggtagcggttcgaatcgcacgt
ggagaaatgagcgcccgggtccaggcgggcgagggaacgctggtaacccgcctggcctcg
tcattcaacggtatggccgaacacatacagcgcctggtgcaggtgcagcgggaaatgatt
cacgcggtttcgcacgaattgcgcactcccgtggcccgtatccgctttggcgtccaaatg
atcgaggactgccaggacgagtctgccctgcaaaggcaactggacggtattgatggcgat
atccaggaactggacgagctgattgatgagatcctgacatatgcgcggctggagcagggc
ggcccggttttctcgctgcaggaaacctcggtaaccgacattgtccgccaggtggtctct
gagcagcagatggtccggcccgagctgagtatcgaaggcaacattgatgaggtctcggaa
cgttgggcgctgtcggatattgagcctcgctacctgcatcgggcgatccagaatctggta
ggcaacgcaggacgctacgcggctggcaaggtgctggtcagctgtcatttcgatgaggac
aactgtcgcgttgacgttgaagacgatggccccggcattccagaggaagactgggagaaa
gtgtttactgcgtttgcccgactggacgacagccgtacccgaacctccggcggctacggc
ctgggtttgtctattgttcgccggattctctactggcacggagggcacgccttcgtcagc
aggagcgacacgcttggcggtgcaaaattcagcctggtctggcccagaaaaaaaccggtg
gactccattgtgtga

DBGET integrated database retrieval system