KEGG   Marinobacter sp. CP1: ACP86_15095Help
Entry
ACP86_15095       CDS       T04052                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mari  Marinobacter sp. CP1
Pathway
mari00620  Pyruvate metabolism
mari00680  Methane metabolism
mari01100  Metabolic pathways
mari01120  Microbial metabolism in diverse environments
mari01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mari00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ACP86_15095
  Energy metabolism
   00680 Methane metabolism
    ACP86_15095
Enzymes [BR:mari01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ACP86_15095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AKV97370
UniProt: A0A0K1UC50
LinkDB All DBs
Position
3273254..3275860
Genome map
AA seq 868 aa AA seqDB search
MLGELLGQSIRRYPGQECYELIEEIRAAAKSDRRQESGSGQRLVNLLRKLSDDELLPVTR
AFNQFLNLANLAEQYHGIRRKRGHQSDLMVESLGEVFERLKQGDVTPEELHQRVADLRIE
FVLTAHPTEVARRTLIMKYDEMSDCLARLDHDDLMPAEREEIVNRLSQLVTEAWHTDEIR
QERPTAVDEAKWGFAVIENSLWQALPQFLRSLDTSLEDATGKGLPLQASPIRIASWMGGD
RDGNPNVTHKVTRRVFLLGRWMAADLYLRDIQALRAELSMWQASDELKAVVGDSREPYRH
VLAELRERLIRTRDWAEASVNGETADANGILFENEDFTGPLELCYRSLVECGLEDIANGP
LLDTIRRAHTFGLPLIRLDIRQEASRHAEAVAEMVDYLGLGDYLSWSEQERQAFLVKELQ
GRRPLVPRTWEPSESVGEVLATCEVVAQQTPEALGSYVISMASKPSDVLSVILLLRESGM
KFPMRVVPLFETLDDLRGAPDSMSALYEVEWYREYCQGRQEVMIGYSDSSKDAGQLMAAW
AQYQAQEKLTHVARQYGVHLTLFHGRGGTVGRGGGPANRAILSQPPGSVNGSFRITEQGE
MIRFKFGLPRLAVQSLTLYTTAVIEATLAPPPQPEDSWRETMDWLTERSLKAYRDVVREN
PDFVPYFRQVTPEQALGKLALGSRPARRKATGGVESLRAIPWIFAWTQMRLMLPSWLGSD
VALEEAARDHRLPVLREMMQGWPFFRTYVDMLEMVLAKADLRIASYYEQTLLDDDRLKAL
GESLRVRLQGCIERLLELKEQTDLLEGEPVFAHSMRVRNPYTDPLHYLQAELLRRDRESE
GKGEVPELVERALKVTMAGIAAGMRNTG
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgctgggtgaacttctgggccagagcatacggcggtatcccggacaggaatgctacgag
ctgattgaggaaatccgggcggcagccaagtccgaccgtcgccaggaaagcgggtccggc
cagcgactggtcaatctgctgcgcaagttgagcgatgatgagctgcttccggtgacccgt
gctttcaaccagttcctgaacctggccaaccttgccgagcagtaccatggtattcgtcgg
aaacgcgggcaccagtctgatctgatggtcgaatcgctcggggaggtgtttgagcggctc
aagcaaggtgatgtcacgccggaggaactgcatcagagggtggcggatctgcgaatcgag
tttgtgctgacggcccaccccaccgaggtggcgcgtcgcacccttattatgaaatacgac
gagatgtcggactgcctggcgcgtctggaccatgacgacctcatgcctgctgaacgggag
gaaatcgtcaatcgcttgtctcaactggttaccgaagcctggcacaccgacgagattcgt
caggagcgaccaaccgcagtggatgaggccaaatggggctttgcggttattgaaaacagt
ctgtggcaggccctgccacagtttctgaggagcctggatacgtcgctggaagacgcgacc
ggaaagggccttcccctgcaggcatcccccatccgcattgcatcctggatgggcggtgat
cgtgatggcaatccgaatgtcacccacaaggtgacccgccgggtcttcctgcttggccgc
tggatggcagcggatctctatcttcgtgatattcaggcgctgcgggccgaactgtccatg
tggcaggccagcgacgagctcaaggccgttgttggtgattcccgggaaccctaccgccat
gtgctcgccgaactccgtgagcggctgatcagaacccgggactgggcagaggcgagcgtc
aacggcgagaccgcggatgccaacggtattctctttgagaacgaggatttcaccggtccc
ctggagctctgttaccgatccctggttgagtgcggactcgaggacatcgccaatggtccg
ctgctggataccatccgccgggcgcatacttttggcctgcctttgattcgtctggacatc
cgccaggaggccagccgccacgcggaggcggttgccgaaatggtcgattatcttggcctg
ggggattatctgtcctggtcagaacaggagcgccaggcattcctggtgaaggaacttcag
ggccggcgcccactggtcccccgaacttgggagccctccgaatcggtcggcgaggtgctg
gcaacctgtgaagtggtggcgcagcaaacgccggaagccctcgggtcctatgttatctcc
atggccagcaagccctctgatgtattgagcgtgattttgctgctcagggaatccggaatg
aagtttccgatgcgggtcgtgcccctgtttgagaccctggatgacctgcgtggtgctcca
gacagcatgtctgcgctgtacgaggttgagtggtatcgggagtattgccagggcaggcag
gaagtgatgatcggctattcggattcctccaaggatgccggccagctgatggcggcctgg
gcccagtaccaggcccaggagaaacttacccacgttgcccgccagtatggcgtgcatctg
accctgttccacggccgtggcggtaccgttggccgtggcggcggacctgccaaccgggcg
atactgtcccagccgccgggctcggtaaacggcagtttccggattaccgagcagggcgaa
atgatccgcttcaagttcggtttgccgaggctggcggttcagagcctgacgctctacacc
acggcggttatcgaagctaccctggccccgccaccacagcccgaagacagctggcgtgaa
accatggactggcttaccgagcggtccttgaaagcctaccgcgatgtggtccgggaaaat
cccgacttcgtgccctatttccgccaggtcacgccggaacaggccctggggaaactggca
ctcggaagtcgcccggcccggaggaaggccaccggcggcgtggaaagccttcgggccata
ccgtggatatttgcctggacccagatgcggctgatgctgcccagttggctgggcagtgac
gtggcgcttgaagaggcggcccgggaccaccggctcccagtattgcgtgagatgatgcag
ggctggccgttcttccgcacctatgtggatatgctggaaatggtgctggccaaggcagac
ctgcgcatcgccagctattatgagcagacgctgctggacgatgatcggttgaaagccctt
ggggagagtcttcgcgtgcgcctccagggttgtatcgagcgacttctggaactcaaggag
caaacggatctgctggagggagagcccgtctttgcgcattcgatgagggtgcgtaaccca
tacacggatccgctgcactaccttcaggccgaattgctacggcgggaccgggaaagtgaa
ggcaagggcgaggtgccggaactggtggaaagagcactgaaagtcaccatggcaggtatc
gctgcgggcatgcggaatactggctga

DBGET integrated database retrieval system