KEGG   Marinobacter sp. CP1: ACP86_15260Help
Entry
ACP86_15260       CDS       T04052                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
mari  Marinobacter sp. CP1
Pathway
mari00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mari00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ACP86_15260
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mari01002]
    ACP86_15260
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mari01011]
    ACP86_15260
Enzymes [BR:mari01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ACP86_15260
   3.4.21  Serine endopeptidases
    3.4.21.-  
     ACP86_15260
Peptidases and inhibitors [BR:mari01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   ACP86_15260
Peptidoglycan biosynthesis and degradation proteins [BR:mari01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   ACP86_15260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Exo_endo_phos
Motif
Other DBs
NCBI-ProteinID: AKV97403
UniProt: A0A0K1UCA3
LinkDB All DBs
Position
complement(3311472..3312974)
Genome map
AA seq 500 aa AA seqDB search
MASLTALAVITTPSVVVAENDNSGFSGNRLWTNQLQDYALKSLHNEDAMSMAAIPLNGPG
INQYINADALMSPGSIMKLVTTFAALEVLGPNHHWDTDFLTDGVMVGDTLKGNLYVRFGG
DPKLTIERLWTTLGELRSMGITRIEGDLILDGSYFQVDGGFPAFEDNGDNPHAPFLVEPS
AYLTNLNLMHFQVRADERGTQAWSTPSLGEVVIDNRVVATAEGPCPSRRNFEWEPIIHED
HRVTVRVTGELPQGCRTTTYLSLLSHEQYSASLIRSLLADLGVVVSGGDLNGVTPEDARL
VMKTTSPDLVTMVRDINKWSSNVMARQLLLTIGAENRQEDESDDRVAGIRVIYDWLENKG
INTAGMVIDNGAGLTRHGRITARQGAQILEHAWNSAYSADLMASMPIIAMDGTMARRLRN
TGMDGEGRIKTGYLENVRSIAGFTRDSNNTTWAVVGMVNNDPAWNGQAVLDRILYSLHFR
PPTGTAISHAASGTSETSIQ
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
ttggcatccctcacggcccttgccgtgattaccaccccgtccgttgtggtcgccgaaaac
gataattccggtttctcgggaaatcgcctctggacgaaccagcttcaggattacgcgctc
aagtccctccacaatgaagatgccatgagcatggccgccattccgctgaatgggcccggc
atcaatcagtacatcaatgccgatgcgctgatgagccccggttccatcatgaagctggtg
acaacctttgcggcgctggaggttctcgggcccaaccaccattgggataccgatttcctg
accgacggtgtcatggtcggagacactctcaagggtaatctctacgtccgcttcggaggt
gatcccaagctcactattgaacgcctctggaccacactgggtgagcttcgcagcatggga
attaccagaatcgagggagacctgatccttgatggttcctactttcaggtagacggtggt
tttcctgcgtttgaagacaacggcgacaacccccacgcgccctttctggtggaaccgtcc
gcctatctgaccaacctgaacctgatgcatttccaggtgcgtgccgatgagcgtggcacc
caggcctggagcacgccctccttgggcgaagttgtgatcgacaaccgtgtggttgccact
gcagaaggcccgtgcccatcacgaagaaactttgaatgggagcccatcattcatgaagac
caccgggtgaccgttcgggtaaccggtgaacttccccagggctgccgaaccactacctat
ctttcattgctgtcccatgagcagtacagcgcctcgttgattcgctccttgctggcagac
cttggcgtcgtagtgtcaggtggagacctgaatggcgtaacgcctgaggatgcccgactg
gtgatgaaaaccacctcgccggacctggttaccatggtgagggacatcaacaagtggagc
agcaacgtgatggcgcgccaactgctcctcaccattggtgcggaaaaccgccaggaagat
gaaagcgatgaccgggttgccggtatacgggtgatctacgactggcttgaaaacaagggc
atcaataccgccggcatggtgatcgacaacggcgctggcctcacccgacacgggcggatc
accgcgcgccaaggcgctcaaatactggaacacgcctggaacagcgcctactcggcagac
ctcatggcctcaatgcctatcatcgcgatggatggaaccatggcacgccgcctgcgcaac
accggcatggatggcgagggtcgcatcaagaccggttacctggaaaatgtgaggtcgatc
gccggattcacccgcgattccaataacaccacctgggccgtggtcgggatggtcaataac
gatcctgcctggaatggccaggccgtgctggaccgcattctgtattcgctgcatttcagg
ccgccgaccgggaccgctatttcacatgcggcttccggcacttctgagactagcattcaa
taa

DBGET integrated database retrieval system