KEGG   Marinobacter sp. CP1: ACP86_17820Help
Entry
ACP86_17820       CDS       T04052                                 

Definition
(GenBank) prephenate dehydratase
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Organism
mari  Marinobacter sp. CP1
Pathway
mari00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mari01100  Metabolic pathways
mari01110  Biosynthesis of secondary metabolites
mari01130  Biosynthesis of antibiotics
mari01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mari00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ACP86_17820
Enzymes [BR:mari01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     ACP86_17820
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     ACP86_17820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT CM_2 ACT TSC22 MtrA DUF5082
Motif
Other DBs
NCBI-ProteinID: AKV97853
UniProt: A0A0K1UDK2
LinkDB All DBs
Position
3877172..3878269
Genome map
AA seq 365 aa AA seqDB search
MSDEQVRLGELRDEIDQLDQKIMELISARAACAQEVAHVKMTANPGQDVFFYRPEREAQV
LRRIKEQNPGPLSGEEMARLFREIMSACLALEKPMHIAFLGPIGTFTQAAALKHFGHSVV
SVPLPAIDAVFREVESGAAHYGVVPVENSTEGMINHTLDMFMSSPLKICGEVQLRIHHHL
LVSPKHGDQEITRIYSHQQSFAQCRQWLDTHRYGIERVTVSSNAEAARRAAEEPGTAAIA
GDMAAELYGLQKLANSIEDRPDNTTRFLIIGREEVPASGHDKSSILVSMRNKPGALYQLL
EPFHRHGLSLTRIETRPSPSGTWAYVFYIDFEGHMEDEQVRKVLAEVDEEAVELKRLGSY
PIGVL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatgagcaggttcggctcggagagctgcgggacgagatcgatcaacttgatcag
aagatcatggagctgatcagtgccagggccgcctgtgcccaggaagtggcgcacgttaaa
atgaccgccaatccggggcaggacgtctttttctatcgccccgagcgggaggcccaggtg
cttcgccgcatcaaggaacagaatccggggccgctgtcgggtgaggaaatggcccgtctg
ttccgggaaatcatgtcggcctgcctggcgctggaaaagcccatgcacattgccttcctg
ggtccgattggcaccttcacacaggcggcagcgctcaagcattttggtcactcggtggtc
agcgtgcctttgccggccattgatgcggtattccgggaggtcgaatccggcgctgctcat
tacggcgtggtgccggtcgaaaactcgaccgagggtatgatcaaccacaccctggatatg
ttcatgtcctcgccgctgaagatctgcggcgaggttcagctgcggattcaccatcacctg
cttgtgtctccgaagcatggcgaccaggaaatcacacggatttattcccatcagcaatcg
tttgcccaatgccggcaatggctggacacccaccgctacggcatcgagcgggttaccgtc
tccagcaatgcggaagcggcccggcgcgcagccgaggagcccggcacggcggctattgcc
ggtgatatggcggccgagctctatggcctgcagaagctggcgaacagtattgaggatcgc
ccggacaataccacacgcttcctgatcattggccgggaggaagtgcctgccagtggccac
gacaagtcgtctatcctggtgtccatgcgcaacaaaccgggggccctgtatcagctcctc
gagccgttccatcgtcacgggctcagcctgaccagaatcgaaacgcggccctcgccaagt
ggcacctgggcctatgtgttctacatcgattttgagggacatatggaagacgaacaggtc
cggaaggttctggcagaagtggatgaagaggccgttgagctcaaacgcctgggttcctac
ccgattggcgttctgtaa

DBGET integrated database retrieval system