KEGG   Marinobacter sp. JH2: MARI_02160Help
Entry
MARI_02160        CDS       T06162                                 

Definition
(GenBank) hypothetical protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
marj  Marinobacter sp. JH2
Pathway
marj00071  Fatty acid degradation
marj00280  Valine, leucine and isoleucine degradation
marj00281  Geraniol degradation
marj00310  Lysine degradation
marj00360  Phenylalanine metabolism
marj00362  Benzoate degradation
marj00380  Tryptophan metabolism
marj00410  beta-Alanine metabolism
marj00627  Aminobenzoate degradation
marj00640  Propanoate metabolism
marj00650  Butanoate metabolism
marj00903  Limonene and pinene degradation
marj00930  Caprolactam degradation
marj01100  Metabolic pathways
marj01110  Biosynthesis of secondary metabolites
marj01120  Microbial metabolism in diverse environments
marj01130  Biosynthesis of antibiotics
marj01212  Fatty acid metabolism
Module
marj_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:marj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MARI_02160
   00650 Butanoate metabolism
    MARI_02160
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MARI_02160
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MARI_02160
   00310 Lysine degradation
    MARI_02160
   00360 Phenylalanine metabolism
    MARI_02160
   00380 Tryptophan metabolism
    MARI_02160
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MARI_02160
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MARI_02160
   00281 Geraniol degradation
    MARI_02160
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MARI_02160
   00627 Aminobenzoate degradation
    MARI_02160
   00930 Caprolactam degradation
    MARI_02160
Enzymes [BR:marj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MARI_02160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: QBM16136
UniProt: A0A4P6W5J8
LinkDB All DBs
Position
207141..207839
Genome map
AA seq 232 aa AA seqDB search
MTELVTYELNNGIATITLSNGKANALSYDVFTALNSALDRAEEDKAIVILTGQPGMFSGG
YDLKEMQKGIDAAMALVKVGSTLTRRLAAFPTPVIAACNGHAIAKGVFVLLSVDYRIGVE
GSFKLGLNEVAIGMTMHHAGIEIARHRMPAPYFYRSVVNAEIFNPESAVSAGILDELVAP
EQLMERAKAVATQYKQLNMRAHKQTKLKVKAEYLATLDRAIEQDADKSDLMG
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
gtgactgaactcgtaacttacgaactgaacaatggtattgccaccattactctgagcaac
ggcaaggccaatgccctgagctatgatgtgtttacggcgctgaactctgcacttgaccgt
gctgaagaagacaaagcaattgtcatcctgacggggcagccgggcatgttctctggcggg
tacgacctgaaagaaatgcagaaaggtatagacgccgccatggctctggtgaaagtgggc
tcaacgttgactcgtcgcctggccgccttcccaacgccagtgattgctgcctgtaatggc
cacgccattgctaaaggcgtgtttgtgctgttgtccgtggattaccgtattggtgtggaa
ggcagcttcaagctggggctgaacgaagtggcgattggtatgaccatgcatcacgccggt
atcgaaattgctcgccaccggatgcctgcgccttatttctaccgctccgtggtgaatgcc
gaaatttttaatccagaaagcgcggtctcggccggtattctggacgaattggttgcaccg
gaacagctgatggagcgtgcaaaagccgtcgctactcagtacaagcaactgaatatgcgc
gcgcacaagcaaaccaagctgaaggtgaaggccgagtacctggccacattggaccgcgcc
attgagcaagacgccgacaagtctgatttgatggggtga

DBGET integrated database retrieval system