KEGG   Marinobacter sp. JH2: MARI_28530Help
Entry
MARI_28530        CDS       T06162                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
marj  Marinobacter sp. JH2
Brite
KEGG Orthology (KO) [BR:marj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MARI_28530 (ahpF)
Enzymes [BR:marj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     MARI_28530 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 HI0933_like DAO Nif11 AlaDh_PNT_C Glutaredoxin FAD_binding_3 PS_pyruv_trans K_oxygenase Thi4 NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: QBM18711
UniProt: A0A4P6WCY0
LinkDB All DBs
Position
3116188..3117753
Genome map
AA seq 521 aa AA seqDB search
MLDANIKQQLNAYMDKLQQPIELVAAYDDSDKSKELKELLDELASMSDKISLRDEESAEV
RRPSFAINRVGTDVGVSFAGIPMGHEFTSLVLALLQVGGHPSKASQDLIEQIQELDGEFE
FETYFSLSCQNCPDVVQALNLISVLNPSIKHTAIDGALFQEEVEQREVMAVPSVYLNGQS
WGQGRMTLEEIVAKLDANAGAKEAEKLNQKDAFDVLVIGGGPAGSAAAIYAARKGISTGL
AAERFGGQVGDTMSIENLISVPYTEGPKLVSAMEQHVNEYDVDVMNLQRAEKLIPAAMKG
GLHEVRLANGASLKSRTVILSTGARWRQMGVPGEEEYRNKGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVGHVTLIEFGEQMRADEVLQKKLRSLSNVDVVTSGQTTEIVGE
NGKVSGLNYKDRTTGEEHHVELEGVFVQIGLVPNTEWLKGDIELSQHGELVINERNETSI
PGVFAAGDATTVPYKQIVISMGEGSKASLSAFDFLIRNEAQ
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagacgctaatatcaagcaacagttgaacgcatacatggacaagctgcagcagccg
attgaattggtagcggcgtatgacgacagtgacaagtccaaagagctgaaagagttactg
gatgagctcgcgagcatgtcagacaaaatcagtctgcgtgatgaagaatctgcggaggtg
cgtcgtccgtctttcgccatcaaccgggtaggcaccgatgtaggcgtgagctttgccggt
attccgatgggccacgagttcacttctttagtactggcgctgttgcaggtgggtggtcac
ccgtcgaaagcttcccaagacctgattgaacagattcaggagttggacggtgagttcgag
tttgaaacctacttctcgttgtcgtgccagaactgcccagacgtggtgcaggctttgaac
ctgatcagtgtattgaatccgagtatcaagcataccgccatcgacggcgctctgttccaa
gaagaagtcgagcagcgcgaagtgatggcagtgcccagcgtgtacctgaatggccagtct
tggggccagggccgcatgacgttggaagagatcgtcgccaagttggatgccaacgccggc
gcgaaagaagccgagaagctgaaccagaaagacgcgttcgatgtgttggtgattggtggt
ggcccggcgggttctgcggccgcgatctacgcggctcgtaaaggtatttcgaccggtttg
gcggctgagcgttttggtggtcaggtgggcgataccatgtccatcgaaaacctgatttcc
gtgccttacaccgaaggcccgaagcttgtgtctgccatggagcagcacgtgaacgaatac
gacgtagacgtgatgaacctgcagcgtgccgagaagttgattccggccgcaatgaaaggc
ggtttgcatgaagtgcgtctggcgaacggcgcctctttgaaatccagaacggtaattttg
tctaccggtgcccgctggcgccagatgggtgttccaggtgaggaagagtaccgtaacaaa
ggtgtggcttattgcccgcactgtgacggccctctgtttaaaggtaagcgcgtagcagtg
attggtggcggtaactccggcgtcgaagcggccatcgatttggccggcattgtcggccac
gtcaccttgatcgagttcggtgagcagatgcgtgcagacgaagtgctgcagaagaaactg
cgcagcctgagcaatgtggacgttgttacctccggccagaccactgaaatcgtgggtgaa
aacggcaaggtcagcggcctgaactataaagaccgcaccaccggtgaagagcaccacgtc
gaactggaaggtgtgtttgtacagattggtttggtaccgaacaccgagtggctgaaaggc
gacatcgagctgagccagcacggtgagctggtcatcaatgagcgcaacgaaacctcgatt
ccgggtgtgttcgctgccggcgatgctaccacggtgccgtacaagcagattgtgatctct
atgggcgagggttctaaagcgtctttgagtgcctttgacttcttgattcgtaacgaagct
cagtaa

DBGET integrated database retrieval system