KEGG   Maribacter sp. 1_2014MBL_MicDiv: YQ22_03650Help
Entry
YQ22_03650        CDS       T04570                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
marm  Maribacter sp. 1_2014MBL_MicDiv
Pathway
marm00380  Tryptophan metabolism
marm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:marm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    YQ22_03650
Enzymes [BR:marm01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     YQ22_03650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: APA63488
LinkDB All DBs
Position
complement(897633..898901)
Genome map
AA seq 422 aa AA seqDB search
MEFKNTLQFAQSLDAQDDLSTYRDEFIFPKINGKEVIYFTGNSLGLQPKRTKSFVDEVMK
DWAELAVEGHFYAEKPWWDYHERLAEPLAKVVGALPEEISVMNTLTVNLHLLMVSFYNPT
QKRFKILCEEKAFPSDQYMFQSQVRFHGLDPDETIVEIKKREGEHHWRTEDILAKIEELG
DELALVLIGGVNYYNGQVMDMEAITKAGKAVGANVGWDLAHAVGNVELKLHEWDADFASW
CSYKYMNSGPGNASGIFVNKKHLNKKDIQRFEGWWGTKKETRFLMKPEFEPMENADAWQI
SNVPVLSVAPYLASLTMFEEVGMDKLIEKRNLIVSYLEYILHEIDKEVDSTFEIITPADR
GCQLSVFLHGQGKALFNYLMENGVVTDWREPNVIRLAPAPFYSTFEDMYRFGQILKEGVL
AN
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggagtttaaaaatacgttgcagtttgcacaatcattagacgcacaagacgacttaagt
acatatagagatgaatttatttttcctaaaattaatgggaaggaggtcatctattttacc
ggtaattctctagggttacagccaaaaagaaccaaatcgtttgtagatgaggtcatgaaa
gattgggcggaacttgccgttgaaggtcatttttatgcagaaaaaccttggtgggactat
catgagcgcctagctgagcccttggcaaaagtagtgggggcgttgcctgaagaaatatcg
gtaatgaatacgcttacggtgaatcttcatttattgatggtctctttttacaaccccact
caaaagagatttaagattctttgtgaagaaaaagcatttccaagtgatcaatacatgttt
caaagtcaagttcgttttcatgggctagacccggatgaaactattgtagagattaaaaag
agagaaggggagcatcattggaggacagaagatatactggcaaaaattgaagagttggga
gatgaactggcacttgttttaattggcggagtaaattattacaatggtcaagtaatggat
atggaagctattaccaaagcaggaaaagcagttggtgccaatgtgggttgggacctagca
catgccgttggtaatgtagaattgaaactgcatgaatgggatgccgattttgcatcatgg
tgtagttataaatatatgaatagcggaccaggaaatgcttctggaattttcgtgaataaa
aaacacctgaataaaaaagatattcagcgttttgaaggatggtggggaaccaaaaaggaa
acccgttttttaatgaagccagaatttgaacctatggaaaatgccgatgcttggcaaata
agtaatgtacctgtgctatcggttgcgccctatttggcttcattgaccatgtttgaagag
gttggaatggacaagttaattgaaaagagaaatctgatcgtatcctaccttgaatatatt
ttacacgaaatagataaagaggtagatagcacttttgaaatcataactccggcagataga
ggctgtcagctttctgtgttcttacatggacagggcaaagcgttgttcaattatttgatg
gaaaatggggtggtgacagattggcgagagcccaatgtaattcgtttagcaccggctcct
ttctattctacatttgaagatatgtaccgttttgggcagatattaaaagaaggagtactt
gccaattaa

DBGET integrated database retrieval system