KEGG   Maribacter sp. 1_2014MBL_MicDiv: YQ22_07545Help
Entry
YQ22_07545        CDS       T04570                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
marm  Maribacter sp. 1_2014MBL_MicDiv
Pathway
marm00240  Pyrimidine metabolism
marm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:marm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    YQ22_07545
Enzymes [BR:marm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     YQ22_07545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: APA64188
LinkDB All DBs
Position
1800584..1801228
Genome map
AA seq 214 aa AA seqDB search
MFLENTVNHKEQFGWIEVIAGSMFSGKTEELIRRLKRAQFAKLKVEIFKPMVDTRYDDEM
VVSHDANEIRSTPVPAAANIRILADTCDVIGIDEAQFFDDEIVTVCNDLANKGVRVIVAG
LDMDFKGKPFGPMPALMATAEYVTKVHAICTRTGNLANYSFRKSSNDKLVMLGEVNEYEP
LSRGAYYKAMLKEKVKTIDVNSEEVNTIKKSENG
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttgaaaacacagttaatcataaagaacaattcggctggatagaagtcattgcc
gggtctatgttttctggaaagacagaagaactgatccgtagacttaaacgtgcccaattt
gccaaattaaaggttgaaatctttaagccaatggttgatacccgttatgatgatgaaatg
gtggtatcgcacgatgcaaatgaaattaggtctactccggtacccgcggcagccaacatt
cgtattttggcagacacttgtgatgttataggcattgatgaagctcaattctttgatgat
gaaatagttaccgtttgcaacgaccttgccaataaaggggtaagggttattgttgcaggt
ctggacatggattttaaaggaaaaccttttggacctatgcctgcgcttatggccactgca
gaatatgttaccaaagtacacgccatttgtacacgaaccggtaatttggccaactacagt
tttagaaaatcgagcaacgataaattggtgatgctaggtgaggttaatgaatatgaaccc
ttaagccgtggcgcctattataaagccatgcttaaagagaaagtgaaaacgatcgatgta
aattccgaagaggtaaatacgatcaaaaaaagcgaaaatggctaa

DBGET integrated database retrieval system