KEGG   Maribacter sp. 1_2014MBL_MicDiv: YQ22_11600Help
Entry
YQ22_11600        CDS       T04570                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
marm  Maribacter sp. 1_2014MBL_MicDiv
Pathway
marm00564  Glycerophospholipid metabolism
marm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:marm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    YQ22_11600
Enzymes [BR:marm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     YQ22_11600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_3 Pyr_redox_2 HI0933_like NAD_binding_8 FAD_binding_3 GIDA GMC_oxred_N Pyr_redox Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: APA64906
LinkDB All DBs
Position
2781991..2783550
Genome map
AA seq 519 aa AA seqDB search
MKRKEMISKLKVTPNTYDFIIIGGGATGIGIALEASARGYSVALLEKSDFTKSTSSKATK
LVHGGVRYLAQGNIGLVREAVVERGLLLKNAPHITKTQSFVIPTHGLYDEILYTIGLTFY
DLLAGRLSLGRSKRLSKTKTLERISLINPDKISAGVLYYDGQFDDSRLAVNTLQSAVELG
AVVANYCAVEGLLKDANGKVTGVKVFDEEGKESFEIKGKQVVNATGVFADDVLQMDAPGS
KKTIAPSQGVHLMLDKSFLPGDDAITIPKTDDGRVLFLVPWHNKVIVGTTDTPVKKESLE
PIALEDEIGFILNTATRYLTKAPKRSDVLSVFAGLRPLAAPSEDGNKTKEISRSHKIFSS
DSGLLTIVGGKWTTFRKMGEDLVDKAERNQQWKHIATKTKNLKIHGYKKDVDLNNPLYFY
GSDEEPLLKLSKEKGWNTTLSNSLGVIEGQVVWAVQNEMALNVEDFLARRTRCQLLDAKE
SVRMAPRVAEIMASELGKDSEWQAKQVEDYKKVTSNYII
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagaaaagaaatgattagtaagttgaaggttacgcctaatacttatgattttatt
ataattggtggcggtgctacgggaattggaatagcattagaggcatcggctagagggtac
tcggtcgctttgttggagaaatcggattttactaaatcaacatccagtaaagcaacaaaa
ttggtgcatggcggagtgagatatttggctcaaggaaacataggcttggtgcgggaggcg
gttgtagaaagaggtcttttgttaaaaaatgcccctcacataaccaaaacccaatctttt
gtgataccaacacatggcctatatgatgaaattctatatactattggcttaacattctat
gatttgttagcgggtagattaagtcttggcaggtctaaacgtttatccaaaacaaagacc
ttagagagaatctctttaataaatcctgataaaatatcggcaggtgtgctatattatgat
ggtcagtttgacgactctcgtttggcggtcaataccttgcaaagtgctgtggaattaggc
gctgttgtggctaattattgtgctgttgaaggtttgttgaaagatgccaacggtaaagtt
accggagttaaggtctttgatgaggaaggcaaagaatcttttgaaatcaagggaaaacag
gtggtgaacgctactggggtatttgctgatgatgtgttgcaaatggatgctcccgggtct
aaaaaaacaattgctccaagccagggtgttcatctcatgttggataagtcttttttacct
ggtgacgatgccattactattcctaaaacagatgatggtagagtgttgttcttagtgcct
tggcataataaggtcattgttggtactaccgatactcccgtgaaaaaagaatctttggaa
cctatagctttagaagatgaaataggatttattttaaacactgcaaccaggtatttgaca
aaagccccaaaacgaagcgatgtcttaagtgtttttgcggggttaagaccgttagcggct
ccaagtgaggacggaaataaaacaaaagagatttcgcgcagccataaaattttttcatca
gattccggtctgttgaccattgttggcggaaaatggaccacatttagaaaaatgggcgaa
gatttggttgataaagcggaaaggaaccagcaatggaaacatattgctactaaaaccaaa
aaccttaaaattcatggttacaaaaaagatgtagacttaaataaccccctatacttttat
ggtagtgatgaagaacctttgttaaaactttccaaggaaaaggggtggaacactactctt
agcaattcattgggtgtaatagaaggacaggttgtgtgggccgttcaaaatgaaatggct
cttaatgtagaagattttcttgcccgtagaacccgttgccagttattggatgccaaggaa
agtgttaggatggccccaagagtggcggaaattatggcgagcgaactaggtaaagactcc
gaatggcaagccaaacaagtagaagattacaagaaggtaacttccaactatattatttaa

DBGET integrated database retrieval system