KEGG   Marinitoga sp. 1137: LN42_00885Help
Entry
LN42_00885        CDS       T04633                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
marn  Marinitoga sp. 1137
Pathway
marn00500  Starch and sucrose metabolism
marn01100  Metabolic pathways
marn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:marn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LN42_00885
Enzymes [BR:marn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     LN42_00885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417 DUF5010
Motif
Other DBs
NCBI-ProteinID: APT75107
LinkDB All DBs
Position
159698..162265
Genome map
AA seq 855 aa AA seqDB search
MEFISRINVLPKVPENLKKLPELSRNLWWTWNYDAQEIFERIDEDLWVEVNRNPVAFLKK
VSQKKLNEAAQNQAILSLYSQVVEKFENYMKAENTWFKSTHKQYKGGEFAYFCAEYGLHE
SFPNYSGGLGVLAGDHLKSASDLGIPLVAVGLLYKQGYFEQRINSEGWQEAIFNPYDFDN
FPVVPVKDDEGNEIYITVEMDNRKVYAKIWKLSVGRINLIYLDTDIPQNDPEDRMITYQL
YGGDQEMRIRQEMLLGIGGVRALRTLGYNPSVWHMNEGHSAFLGLERIREFVQEHGLTFR
EAVQAAKAGAVFTTHTPVPAGHDAFPFHLMDKYFKDYWPQLKASRREFLDLGAEIRADGS
ELFSMTTLALNLSSRANGVSKLHGEVSRDLAKDIWKGLEAVEVPITHVTNGVHATTWISK
ELQDLFAHYLGKDWHEKIDDPDLWKKIDEIPDEELWNVRKSLKKKLIEFVHQRTKEQRMR
HGETVEQLEEIENILNPKALTIGFARRFATYKRATLIFKDLERLSKILNNPERPVQLIFA
GKAHPADRPGQELIKRIYEISRMPEFKDKIVFIENYDMNVARHLVAGVDVWLNNPRRPRE
ASGTSGQKAGMNGSPNFSVLDGWWVEGYNGKNGWAIGDERDYTDLELQDRIDSSSMYNTL
EKEIVPLYYDHNEELGVSREWIKIMKESIKSVTSFFNTHRMLKEYTQKLYMTAAELGEKF
VKDNFEIAKKFSAWVEILEKNWGNIRIKVLSNVTEDIEYSTGGKIEVKAEVYLPGIGPDS
VLTQIVVAKLEDNKIVTLKSFDMKLKKEVNKDTYLYEGEFEIDERGQYGWNVRVIPYNPI
MPYQHYLIGFVKYPQ
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atggaatttatttcaaggataaatgtattaccaaaagtgcctgaaaatttaaaaaaatta
ccagaattaagtagaaatctctggtggacctggaattatgatgcacaggagatttttgaa
agaattgatgaagatttatgggttgaagtaaatagaaatcctgttgcatttttaaaaaag
gtaagccagaaaaaattgaacgaggcagcgcaaaatcaggctatattgagtttatactct
caggtagtggaaaaatttgaaaattatatgaaagctgaaaatacatggtttaaatccaca
cataaacaatataaaggtggagaatttgcatatttttgtgctgaatatggattacatgaa
tcatttccaaattattctggaggattaggtgtattagctggtgatcatttaaaatcagca
agtgatttgggaattccattggttgctgttggacttttgtataaacagggatactttgaa
caaaggattaattctgaaggctggcaggaagctatttttaatccttatgattttgataat
tttcctgtagttccagtaaaagatgatgaaggaaatgaaatttatataacagtagaaatg
gataatagaaaagtttatgcgaagatatggaaattatccgttggaagaataaatttaatt
tatcttgatacagatattccgcaaaatgatcctgaagatagaatgattacctaccaatta
tatggcggggatcaggaaatgcgaataaggcaggaaatgcttttgggtattggaggagtt
agagcattaagaactcttggatataacccatcggtatggcatatgaatgaaggtcattct
gcatttttaggtttagaaagaattagagaatttgttcaggaacacggtttaacatttaga
gaagcagttcaagcagcaaaagctggtgcggtatttacaacacatactcctgttccagca
ggtcatgatgcatttccttttcatttaatggataaatatttcaaagattattggccacaa
cttaaagcatcaagaagggaatttcttgacttaggagctgaaataagggctgatggttct
gaattattttcaatgacaacattagctttaaatttatcctcaagagcaaacggagtaagt
aaattacatggtgaagtatcacgagatttagcaaaagacatatggaaaggacttgaagca
gttgaggttccaattacacatgtaacaaatggtgttcatgcaacaacatggatttccaaa
gaattacaggatttatttgctcattatcttggaaaagactggcatgaaaagattgatgat
cctgatttatggaaaaaaattgatgagattccagatgaagaattatggaatgtaagaaaa
tctttaaagaaaaaattaattgaatttgtacatcaaagaactaaagaacaaagaatgaga
catggtgaaacagtagaacaacttgaagaaatagaaaatattcttaatccaaaggcttta
acaataggttttgcaagaagatttgcaacatataaaagagctacattaatttttaaagac
cttgaaaggctcagtaaaattttaaataatccagaaagacctgttcaattgatttttgcg
ggtaaagcacatccggcagatagaccaggtcaggaattaataaaaagaatttacgaaatt
tcaagaatgcctgaatttaaagataaaatagtatttattgaaaattatgatatgaatgtt
gcaaggcatttagtagccggtgttgatgtatggcttaataatccacgaagaccaagagaa
gcaagtggaacaagtggtcaaaaagctggtatgaacggttctccgaactttagtgttctt
gatggttggtgggttgaaggttataatggaaaaaatggatgggctataggtgatgaaaga
gattacacagaccttgaattacaggatagaatagatagttcatcaatgtataatactctt
gaaaaagaaattgtacctctttattatgaccataatgaagaattgggagtttcaagagaa
tggataaaaataatgaaagaatctataaaatcagttacatcattctttaatacacataga
atgctcaaagaatatacacaaaaattatatatgactgcagcggaattaggagaaaagttt
gtaaaagataattttgaaatagctaagaaattctctgcttgggtagaaatattggagaaa
aactggggaaatattagaataaaagttctttcaaatgtaactgaagacattgaatattca
actggtggaaaaatagaagtaaaagcagaagtttatttaccgggaattgggccggattct
gtacttacacaaattgttgtagcaaaattggaagacaacaaaatagttacattaaaatcg
tttgatatgaagttgaaaaaagaagtaaataaagatacatatttgtatgaaggtgaattt
gaaatagatgaaagagggcagtatggctggaatgtaagagttattccatataatcctata
atgccatatcaacattatttaataggttttgtaaaatatccacaataa

DBGET integrated database retrieval system