KEGG   Marinitoga sp. 1137: LN42_03095Help
Entry
LN42_03095        CDS       T04633                                 

Definition
(GenBank) cytochrome C oxidase subunit II
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
marn  Marinitoga sp. 1137
Pathway
marn00500  Starch and sucrose metabolism
marn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:marn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LN42_03095
Enzymes [BR:marn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     LN42_03095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-ProteinID: APT75489
LinkDB All DBs
Position
complement(597091..598497)
Genome map
AA seq 468 aa AA seqDB search
MPEYNEKTKSGLWVELSKKIPDLALMGITALWLPPAYKGQAGKSDVGYGVYDLYDLGEFN
QKGTISTKYGTKEQYLKLIENAHLYNIQVYGDIVFNHKMGADNTEWVNATKVSWNNRNIE
IENKTIKAWTLFNFPGRNNKYSDFKWRWYHFDGVDWDQNTGEKAIFRFNGIGKAWDWEVD
DENFNYDYLMGADLDMDHPEVVQELKKWGKWYVNFTKIDGFRLDAVKHIKFSFFNDWLDY
MRNVLGKELFTVGEYWSTDINKLENYISKTEGRMSLFDVPLHQHFYEASNSGGYYDMRNI
FNGTLVQKNPIKAVTFVENHDTQPGQSLSSPVQDWFKPLAYAMILLRKDGYPCVFYGDMY
GAPGIKEQYGTIKKLIEARKLYSYGKQYDYLDHQDIIGWTRLGDEEHPKSMAVILSDGPG
GSKWMYVGKKKTKFIDLLGNIKEEIWTNDYGWAEFKVNGGSVSVWVEE
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
ttgccagaatataatgagaaaaccaaaagcggattatgggtagagttatcaaaaaaaatt
ccagatttagccttaatggggataacggcattatggcttccaccagcatataaagggcag
gcaggaaaaagtgatgtggggtatggagtctatgatttgtatgatcttggagaattcaat
caaaaaggtactatttcaacaaaatacggaacgaaagaacaatatttaaaattaattgaa
aatgcccatttatataatatacaggtttatggcgatattgtatttaatcataaaatggga
gcagataatacagaatgggttaatgcaacaaaagtttcatggaataataggaatattgaa
attgaaaataaaacaataaaagcatggacactttttaattttccaggacgaaataataaa
tattcagattttaaatggagatggtatcattttgatggtgtagattgggatcaaaacact
ggtgaaaaagctatattcaggtttaatggaattggaaaggcatgggattgggaagtggat
gatgaaaattttaattatgattatttaatgggtgcagatcttgatatggatcatcctgaa
gttgtacaagaacttaaaaaatggggtaaatggtatgttaattttacaaaaattgatgga
tttagattagatgctgtaaaacacataaaatttagtttttttaatgattggctggattat
atgagaaatgtattaggaaaagaattatttacagttggagaatattggagtacagatatt
aataaactagaaaattatatatcaaaaacagaaggtagaatgtctctctttgatgttcca
ttgcatcaacatttttacgaggcatcgaattctgggggctattatgacatgagaaatatt
tttaatggaacacttgttcagaaaaatcctataaaagctgttacttttgttgaaaatcat
gacacacagcctggtcagtctttatcttctcctgtacaggattggtttaaacctttagct
tatgcaatgattctattgcgaaaagatggttatccatgtgttttttatggggatatgtat
ggtgctcctggaataaaagaacaatatgggacaattaaaaaacttattgaagcaagaaag
ttatattcatatggaaagcaatatgattatttagatcaccaagacataattggttggaca
agattgggagacgaagaacacccaaaaagcatggcagtaatactttcggatggtcctggt
ggaagcaaatggatgtatgttggaaagaaaaaaacaaagtttatagatttgctggggaat
ataaaagaggaaatttggacaaatgattatggatgggcagaatttaaagttaatggaggt
tctgtctctgtttgggtagaagaataa

DBGET integrated database retrieval system