KEGG   Marinitoga sp. 1137: LN42_06245Help
Entry
LN42_06245        CDS       T04633                                 

Definition
(GenBank) aldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
marn  Marinitoga sp. 1137
Pathway
marn00030  Pentose phosphate pathway
marn01100  Metabolic pathways
marn01120  Microbial metabolism in diverse environments
marn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:marn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LN42_06245
Enzymes [BR:marn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     LN42_06245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N Nudix_hydro
Motif
Other DBs
NCBI-ProteinID: APT76024
LinkDB All DBs
Position
1244624..1246423
Genome map
AA seq 599 aa AA seqDB search
MSFNGKVLRVNLTEKSVKVEKLPEDYELYLGGRGLATKMFYDEVGPQVDPFSPENKLFFA
TGPLTGTAAPTGGRYMVVTKGPLTGTIASSNSGGYFGAELKFAGYDMIIIEGKAEKPVYL
MIKDDHVELKDASHLWGKDVFETTDIMMEEIGDPRARVACIGPAGEKLVKFAAIMNDKHR
AAGRTGVGAVMGSKNFKGIVVRGTKRPEVKDPAKFMEVVKEKIKKLRENGITGEGLPKLG
TKVLDNIINQNGLYPTRNFQDSVFEFTDEVSGEALVEKGYLVKNMPCFGCPIACGRRVTL
PNGIETEGPEYETGWAFGPDCGVSDLIAIVEANHLCNKYGLDTISAGSTIACAMEMYEKG
IVKKEELGNGPELKFGSSEAVVFYTKQIGLREGIGDKLAEGSYRFAESYGHPEFAMVVKK
QEIPAYDPRGAQGHGLEYATSNRGGCHVRGYMISPEILGAPEKIDPQALEGKAEWVKAFQ
DLTAVIDAGGLCLFTSFALGADDYADLINAALGWNKSTEEILKIGERIWNLERKFNLEAG
IDPSQDTLPKRLLEEPVKEGPNKGQVVHLDQLLPKYYEVRGWSKEGIPTEEKLKELGIL
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
gtgtcatttaacggaaaagtattaagagtaaatcttaccgaaaaaagcgtaaaggttgag
aaactgccagaggattatgagctctatcttggtggaagaggccttgcaacaaagatgttc
tacgacgaagtaggccctcaagtggatcccttctcacctgaaaacaaattattctttgca
acaggtcctttaacaggaactgccgcaccaacaggtggaagatatatggtagtaactaaa
ggtccgttgacaggcaccatagcttcaagtaactcaggtggttattttggtgcagaattg
aaatttgcaggttatgacatgattattattgaaggaaaagcagaaaaacctgtatacctt
atgattaaagatgatcatgtagaacttaaagatgcttctcatctctggggaaaagacgta
tttgaaaccactgatataatgatggaagaaattggagatccaagagcaagagttgcatgt
attggaccagcaggagaaaaattggtaaaatttgcagctattatgaacgataaacataga
gctgcaggtagaaccggtgttggtgcagtaatggggagtaaaaacttcaaaggtatcgtt
gtaaggggaacaaagagacctgaggtaaaagatccagcaaaattcatggaagttgtaaaa
gaaaaaatcaaaaaattaagagaaaatggaattaccggtgaaggtttgcctaaactggga
accaaggttctcgataatattattaatcaaaacggattatatccaacaagaaacttccag
gattcagtatttgaatttacagatgaagtttccggcgaagcgcttgttgaaaaaggatat
ctcgttaaaaatatgccatgttttggctgtcctatagcctgtggaagaagagtaacactt
cctaacggcattgaaacagaaggtccagaatatgaaactggttgggcatttgggccagat
tgtggcgtttcagacttaattgctatagttgaagcaaaccatctatgtaataaatatggt
ttagacacaatttcagcaggttcaacaattgcatgtgcaatggaaatgtatgaaaagggc
attgtaaagaaagaagaattaggaaatggtcctgaattgaaatttggaagttcagaagct
gtagtattctatacaaaacaaattggattaagagaaggaattggcgacaaattagcagaa
ggttcttatagatttgcagaaagttatggacatcctgaatttgccatggttgttaaaaaa
caggaaattcctgcatacgatccaaggggtgctcagggacatggtcttgaatacgcaaca
agtaacagaggcggatgtcacgttagaggttatatgatttctcctgaaattctcggtgct
cctgaaaaaatagatccacaagcacttgaaggaaaagcagaatgggttaaagcattccag
gatttaacagcagttatagatgctggaggattatgtttattcacctcattcgcattaggt
gctgacgattatgctgatttaataaacgctgcattgggatggaataaatcaacagaagaa
atattaaaaattggcgaaagaatatggaatcttgaaagaaaattcaatttagaagcagga
atcgatccttcacaggatacacttccaaagagattgctcgaagaacctgtaaaagaaggt
ccaaacaaaggtcaggttgttcatcttgatcaattgcttccaaaatattacgaagtaaga
ggatggagcaaagaaggtattcctacagaagaaaaactcaaggagttaggaattctatga

DBGET integrated database retrieval system