KEGG   Marinitoga sp. 1137: LN42_08675Help
Entry
LN42_08675        CDS       T04633                                 

Gene name
tdh
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
marn  Marinitoga sp. 1137
Pathway
marn00260  Glycine, serine and threonine metabolism
marn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:marn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LN42_08675 (tdh)
Enzymes [BR:marn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     LN42_08675 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C NAD_binding_7 AdoHcyase_NAD AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: APT76441
LinkDB All DBs
Position
complement(1763776..1764813)
Genome map
AA seq 345 aa AA seqDB search
MKAIVKKEPGKGFSLEEVEIPEIKEPNDVKVKVLNASICGTDLHIWKWDEWSQQRIKTPQ
IDGHEFVGEVVEVGPMVKGLKPGDIVAAETHIPCGVCKQCKTGKMHICKNMQILGVDRDG
VFAEYVVVPEIVLWKLDPSIPREFASVMEPLGNAIHTATAVDLRGKTVLITGAGPIGVMA
VQVAKVSGAATIIVSEPSEYRMNMAKEMGADYIINPLEENLVEEVMKLTNDDGADVLLEM
SGNPNALNQGINALTNGGDAVILGVFPTNPVPFEMNTAVFKGINIHCITGRKMFETWQIA
SEWLRTKKLDLSKVITHVLPMEEFEKGFEIMNSKKSGKIILKISE
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctattgtcaaaaaagaacctggaaaaggattttcgcttgaagaagttgaaatt
cctgaaattaaagagccaaatgatgtaaaggttaaagttttaaatgcttccatatgcgga
actgatttacatatctggaaatgggatgaatggtcacagcaaagaattaaaactccacaa
attgatggtcatgaatttgttggtgaagttgttgaagttggtcctatggtaaaaggatta
aaaccgggagatattgttgctgcagaaacacatattccatgtggcgtttgtaaacaatgt
aaaactggtaaaatgcacatatgtaaaaatatgcagatattaggtgtggatagagacggt
gtttttgcagagtatgttgtagtacctgaaattgtgttatggaaacttgatccatctata
ccaagagagtttgcttctgttatggaaccccttggaaacgctatacatacagctactgca
gttgatttaagaggaaaaaccgttttaattacaggtgcaggtccaattggagttatggct
gttcaggttgcaaaggtatctggtgctgctacaataatagtaagtgaaccttcagaatat
agaatgaatatggctaaagaaatgggagcagattatattataaaccctcttgaagaaaat
cttgtagaagaagttatgaaattaacaaatgatgatggcgcagatgttttacttgaaatg
tcaggtaatcctaatgctttaaatcaaggaataaatgctttaactaatggcggagatgct
gttatacttggcgtttttccaactaatcctgttccatttgaaatgaatactgccgtattt
aaaggtataaatatacattgtattacaggaagaaaaatgttcgaaacatggcaaatagca
tcagaatggctaagaacaaaaaaactcgatctttcaaaggttattacacatgtattacca
atggaagaatttgaaaaaggttttgaaattatgaattctaaaaaaagtggtaaaataatc
cttaaaatctctgaataa

DBGET integrated database retrieval system