KEGG   Marinilactibacillus sp. 15R: BKP56_00570
Entry
BKP56_00570       CDS       T04573                                 

Definition
(GenBank) transcription-repair coupling factor
  KO
K03723  transcription-repair coupling factor (superfamily II helicase) [EC:3.6.4.-]
Organism
marr  Marinilactibacillus sp. 15R
Pathway
marr03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:marr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    BKP56_00570
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:marr03400]
    BKP56_00570
Enzymes [BR:marr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     BKP56_00570
DNA repair and recombination proteins [BR:marr03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     TRCF (transcription-repair coupling factor)
      BKP56_00570
SSDB
Motif
Pfam: CarD_CdnL_TRCF TRCF UvrB_inter DEAD Helicase_C ResIII UB2H AAA_22 ATP-synt_ab DUF1474
Other DBs
NCBI-ProteinID: API87918
UniProt: A0A1L4BVQ2
LinkDB
Position
complement(123169..126711)
AA seq 1180 aa
MSTITSFLSEKPSVQKVFSTIGQRQTQLITGIAGSARALLLSSLLKEKQKQIVIIAQNLY
HANQLMADLTGLVPDDQLFVFSVDDMIHAEMAIASPEARAERVQALDYLLSGKPGIVIIP
LSGIRKLLPPKEIFQASHINIELGAEIEFDHFAESLIGMGYRREQKVAAPGEFSIRGGII
DVYPLTEENPVRIELFDVEVDSLRFFDADTQRSIENVSKISLIPATDFLVTKEQMKPAAE
KLKKALSRNLAALTDNEAKQILSKQLNSVIRGLETGELTDDLVKFRDFVYEKHSSIIDYM
ADDAILAMDEYPRILEKDALLNEEEAEWATSQLSQRLVLQKQTFSNDFREELKKNQHDTL
HFALFQKGMGGLRFDAIHPFQYRNMQQFFGQMHLLKTEMDRWEKLGYTVVVMTADAERAD
KVNRTLLDFEIPSILSGNGEIQEKKIQVISSTVQNGFELPTEKLAVLTEKELFNRVNRKK
VRRQNITNAERLKSYTELNPGDFVVHVNHGIGRYTGMETMEIGGVHQDYMSIIYDNDSKL
FIPVTQVNLLQKYVSSEGKTPKINKLGGTAWAKTKRKVASQVEDIADDLIELYAERERKT
GFPFSEDNEYQHEFDEAFPYTETDDQLRSIKEVKRDMEKDKPMDRLLVGDVGYGKTEVAM
RAIFKAVQDGKQAAILVPTTVLAQQHYETMLERFSDFPVEIGLMSRFRTGQQMKKLTEEL
RKGQVDVVVGTHRILSKDVVFQDLGLLVVDEEQRFGVKHKERLKQLKNEVDVLTLTATPI
PRTLHMSMLGVRDLSVIETPPANRYPVQTYVMEMNGAVVGEAMKRELARGGQVFYLHNRV
STIDQRAEELQQLVPDARIGIAHGQMSEGQLENVLFEFIQGEFDILVTTTIIETGIDMPN
VNTLLVEDADRMGLSQLYQLRGRVGRSSRIAYAYFMHQPNKILTEVSEKRLQAIKDFTEL
GSGFKIAMRDLSIRGAGNLLGQQQHGFIDSVGFDLYSQMLSEAVARKRGDTAQLQTNVEL
DLSVDAYLPSTYIEDERQKIELYKRIREFASDQDYVELQDELIDRFGDYPQEVSDLLTVG
LLKMYSDRALIETIKRDKQKVAVTFSKEGTQTLPLPEVFKALKKISLKTNMNTNDRLSID
FKLPVRLVDNEWLDSLVLFSKNISEFQMNKKEAVAGKGNE
NT seq 3543 nt   +upstreamnt  +downstreamnt
ttgtcaacgattacaagttttttatcagaaaaaccctctgttcaaaaggttttctctact
attggacagagacagacgcaattgattaccggaattgctggttctgctagagcattactc
ctttcttctttattgaaagaaaaacaaaagcagatcgtgattatagcacaaaatttatat
catgctaatcaactgatggcagatttaactggtctagttcctgatgaccagttatttgta
ttttcagtcgatgatatgattcatgctgaaatggcgattgcttcgcctgaagctcgggca
gaaagagtgcaagcgctagattatcttttatctgggaaacctgggattgttattatcccg
ctttctggtattagaaaattattgccacccaaagaaatatttcaagcatctcacatcaat
attgaactgggtgccgaaatcgagtttgaccactttgctgaatcgcttataggaatggga
tatagaagagaacaaaaggttgctgctccaggagagtttagtatcaggggaggcattatt
gatgtctatccattgacagaagaaaatcctgtaagaattgagctgtttgatgtagaggtt
gattcattgaggttttttgatgcagatacccagcgctcaatagaaaatgtaagtaaaatt
tctttaatacctgcaacagattttctagtaacaaaagagcaaatgaagccagcagctgaa
aagctgaaaaaagcactatcgagaaatttagcagctctaactgataacgaagctaagcaa
atattgagtaagcaattaaattctgtgattagaggattggaaaccggtgaattgacagat
gatctagtcaaattcagagattttgtgtacgaaaagcattcttctataattgattatatg
gcagatgatgcaattttagcaatggatgaatatccaagaattctagagaaagatgctctt
ttgaatgaagaagaggcagaatgggctacttcccagttgagccagcggctagttttacag
aaacagactttttcaaacgactttagagaagagcttaaaaaaaatcaacatgatactttg
cactttgctttattccagaaaggtatgggaggtttgcgttttgatgcaattcatcctttc
cagtaccgaaacatgcagcaatttttcgggcaaatgcatttgttgaaaacagaaatggat
cgctgggaaaaattaggatacactgtagttgtaatgacagcagatgcagagcgagcagat
aaagtgaatcgtacattactggattttgaaattccgagcatcctttcaggaaatggagaa
atacaagaaaaaaaaatacaagttatttcatcgactgttcaaaacggatttgaattgcct
actgaaaaattggccgttctgactgaaaaagaactatttaatcgtgtcaatcgcaagaaa
gtacgtcgtcagaatataacaaacgctgaaagactaaaaagttatacagaattgaatcca
ggagattttgttgttcacgttaatcacggtatcggaagatacactggaatggaaacaatg
gaaattggtggagtccatcaagactatatgtctatcatatatgataatgactctaaatta
tttattccagtcacccaagtaaacttgctgcagaaatacgtatcttcagaagggaaaacg
cctaagataaataagttaggcgggactgcctgggcaaaaacgaagagaaaagttgcgagc
caagtagaggatattgcagatgatctgattgaattatatgctgaaagagaaaggaaaacg
gggtttcctttttcagaagataatgaatatcagcatgaattcgacgaagcatttccctat
accgaaacagatgaccagcttcgttcaattaaagaagttaaacgagacatggaaaaagat
aaaccaatggatcgtctattagttggagatgttggatatgggaaaaccgaggtcgcaatg
cgggcaatttttaaagctgtacaagacggaaaacaagcggctatattagtaccgacaact
gtcttagcccagcagcattatgaaaccatgttagaacgttttagcgattttccagttgaa
attggattgatgagtcggtttagaactggtcagcaaatgaaaaagttaacagaagaattg
cgtaaaggacaagtagatgtagtagtaggaacccacagaattttatctaaagatgttgtg
tttcaagatttaggcttactagttgttgatgaagagcagcgctttggagttaaacataaa
gaacgattgaagcagttgaagaacgaagttgatgtattaacgctgactgcgactcctatc
cctagaaccttacacatgtctatgcttggagtgagagacttatcagtaattgagactccg
ccggctaatcgctatcctgtccaaacttatgttatggaaatgaatggtgccgtggttggt
gaagcgatgaagagagaactggctcgaggtggacaagttttttatctgcataatcgtgta
agtacgattgaccagagagctgaagaacttcagcagcttgttccggacgcacgtataggt
attgcgcatggccagatgtcagaaggacaactggaaaatgtattattcgaatttattcag
ggagagtttgatatattagttacaacgacgattattgagactgggattgatatgcccaat
gtcaatacacttctagtcgaggatgctgatcgcatgggcttgtcacagctgtatcagcta
agaggtcgtgttggtcgaagcagtcgaattgcttatgcttatttcatgcatcagccgaat
aaaattttaacagaagtcagtgaaaaaagattacaggcaatcaaagattttactgaactt
ggttccggatttaagattgcaatgagagatttatctattcgaggagctggaaatttattg
ggtcagcaacagcatgggtttattgattcagttggattcgatctctattctcagatgtta
tcagaagcagtagctagaaaacgaggagacactgcacagctgcagacgaatgttgaacta
gatctttcagtagatgcgtatcttccaagcacatacattgaagatgaaagacagaaaatc
gagttatataaacgtatacgtgaatttgctagtgaccaggactatgtggaactccaagat
gaattgattgaccgtttcggagattatcctcaagaagtctctgatctgttaacagttgga
ttgcttaaaatgtatagcgatagagcattgattgaaacaattaaacgagataagcaaaag
gtggctgttaccttctccaaagaagggacgcaaactttaccgttaccagaagttttcaaa
gctttgaaaaaaatcagtctgaaaacaaatatgaacacaaatgaccgtttgagtatcgat
ttcaagctgcctgttagattggtggataatgaatggctagattcattagttttgttttcc
aaaaacatttcagaatttcaaatgaataaaaaagaggcagtagcaggtaaaggaaatgaa
tag

DBGET integrated database retrieval system