KEGG   Marinilactibacillus sp. 15R: BKP56_02780Help
Entry
BKP56_02780       CDS       T04573                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
marr  Marinilactibacillus sp. 15R
Pathway
marr00500  Starch and sucrose metabolism
marr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:marr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BKP56_02780
Enzymes [BR:marr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BKP56_02780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: API88292
UniProt: A0A1L4BWS1
LinkDB All DBs
Position
complement(567862..569319)
Genome map
AA seq 485 aa AA seqDB search
MAYNGTMMQYFEWDLANDGTHWKKLKEEAAHLREIGVTAVWIPPCFKSLDQKDVGYGIYD
LYDLGEFDQKGTIRTKYGTKEELLDAIHTLHEHGIQVYADVVLNHKAGADGTEKFWAVAV
NEDNRHEEIEEAKEIESWTYFNFPGRQGKYSDFEWHWYHFSGVSDDEITGEQGIYRIEGE
GKGWAPDENVSTEFGNFDYLMFADIDYSHPEVIKETKKWVKWFIEETGIDGIRLDAVKHI
DRMFMKELIEEVRAEYGEDFFFVAEYWHQKYKYLEEYLEDQEFNISMMDVRFHYALHEAS
QQKTNFDLRRLFDGTLYKKNAEQAVTFVENHDSQPGQSLESYVEPWFKPLAYGIVLLSTY
GYPCLFYSDYYGYSGEVDYEGCPDIIERLMHIRTEYAYGEQYNYLDHATCLGFTRTGDDE
HPEGCAVVLSSGEEGYKEMNVGDLHAGEHYIDKLGNREEEIEIGEEGTAVFPVNAESISV
WIPKK
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggcttataatggaacaatgatgcagtattttgaatgggacttagcaaatgatgggact
cactggaaaaaactgaaagaagaagcggctcatttaagagaaataggagtaacagctgta
tggattcccccctgttttaaatcattggatcaaaaagatgtaggctacggtatatatgat
ttgtatgatcttggagaatttgatcaaaaaggaacaattcgaactaaatatggaacaaaa
gaagaattactagatgccattcatacattacatgaacacgggatacaagtttatgctgat
gtagtcttgaatcataaagctggagcagatggaacagaaaaattctgggcagttgcagtc
aatgaggataatagacatgaagaaattgaagaagcaaaagaaattgaatcttggacttat
tttaattttccaggaagacaagggaaatattctgactttgaatggcattggtatcatttc
tcgggtgtatctgatgatgaaattactggagaacagggaatttatcgtatcgaaggagaa
ggtaagggttgggcaccggacgaaaatgtatcgactgaatttggtaattttgattactta
atgtttgcggatattgattatagtcatccagaagttattaaagaaacaaaaaaatgggtt
aaatggtttatagaagaaactggaattgatggaattcggttagatgcagttaagcacatt
gatcgtatgtttatgaaagagctgattgaagaagttcgtgcagaatatggtgaagacttt
ttctttgtagcggaatactggcaccagaaatataaatatttagaagagtatttagaagat
caagagttcaatatctctatgatggatgtaaggtttcattatgccttgcatgaagcttct
cagcagaaaacaaattttgatttgagaagactatttgatgggacactttataaaaagaat
gcagagcaagctgtgacgtttgtagaaaatcatgattcgcagccaggacagtctttagag
tcctatgtagagccctggttcaaaccattagcatatggtattgttttgttgagtacctat
ggatatccttgtcttttttatagtgattactacgggtatagtggtgaagttgattatgag
ggctgtccggatattattgaaagattgatgcatatcagaacagaatatgcttatggtgaa
cagtataattatcttgatcatgctacttgtctaggatttacacgtacaggtgatgatgaa
catcctgaagggtgtgcggtcgtattatctagtggagaagaaggatacaaggaaatgaat
gttggtgacctgcatgcaggagaacactatatagataaactaggtaacagggaagaagaa
attgaaattggtgaagagggaactgcagtatttccagtgaatgcagaatcaatttcagta
tggattcctaaaaaatag

DBGET integrated database retrieval system