KEGG   Marinilactibacillus sp. 15R: BKP56_10330Help
Entry
BKP56_10330       CDS       T04573                                 

Definition
(GenBank) flagellar protein export ATPase FliI
  KO
K02412  flagellum-specific ATP synthase [EC:7.4.2.8]
Organism
marr  Marinilactibacillus sp. 15R
Pathway
marr02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:marr00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    BKP56_10330
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:marr02044]
    BKP56_10330
   02035 Bacterial motility proteins [BR:marr02035]
    BKP56_10330
Enzymes [BR:marr01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     BKP56_10330
Secretion system [BR:marr02044]
 Type III secretion system
  Flagellar export apparatus
   BKP56_10330
Bacterial motility proteins [BR:marr02035]
 Flagellar system
  Flagellar assembly proteins
   Type-III secretion
    BKP56_10330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab T3SS_ATPase_C ATP-synt_ab_N ABC_tran RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: API89630
UniProt: A0A1L4C0K0
LinkDB All DBs
Position
complement(2095044..2096369)
Genome map
AA seq 441 aa AA seqDB search
MLNIPFEQYHDVIEKSAYTLKQGKVSQVIGLIIKVDGLDAFVGEVCEIKIKSTNKIVLSE
VVGFVDETVLLMPLDELEGIGPGCLVRPTRKTLKVEVSDDMLGMTLDGLGRPLTEKQLLN
GKMYQVNRSSPDPFKRKKIRNILTTGVKAVDGLLTVGEGQRMGIFAGSGVGKSTLLGMMA
RYSEADVIVIGLIGERGREVLEFIDKDLGEEGYAKSVVVCATSDMPPLVRLKGAYVATAI
AEFFRDQGKKVVLMMDSVTRVAMAQREIGLATGEPPTSKGYTPSVFTTLPKLLERSGTSQ
FGSITAFYTVLVEGDDMNEPIADSVRGILDGHIILSRKIASENHYPAIDIPNSLSRLMKE
LVSPEQDELAGKLRENLTRYSDSKDLIDVGAYQKGSNPLVDQAVRLNRPIKEFLKQKTTE
EYKYEETLEELKSVFSAQPLR
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgctcaatatcccttttgaacaatatcatgatgtaatagaaaaaagtgcctatactttg
aaacaaggaaaagtaagtcaagttattggtttgataatcaaagtagacggacttgatgct
ttcgtaggagaagtctgtgagataaaaataaaatctactaacaaaattgtattaagtgaa
gtcgttgggtttgttgatgaaacagtcctcttgatgccgctagatgaattagaaggcatt
ggaccgggatgtctagttagaccgacaagaaaaacacttaaagtagaagtttctgatgat
atgctgggaatgactttggatggattaggtaggcctttaacagaaaaacagcttctcaat
ggaaaaatgtatcaagtcaatcgttcctctcctgatccttttaaacgaaagaaaatcaga
aatattttaactactggggttaaggctgttgatggattactaacagttggagaaggtcag
cgtatggggatttttgctggttctggtgtaggtaaatctactttactaggcatgatggcc
cgttattcagaagctgacgtaattgttattggcttgattggcgaacgtggtcgagaagtt
ctggaattcatcgataaggacttaggtgaagagggatatgccaagtctgttgtagtttgt
gcaacctctgatatgccaccacttgttagattaaaaggagcatatgtagctacggctatt
gcagaattttttagagaccagggcaagaaggttgtattaatgatggattcagttacccgt
gttgcaatggcacagcgtgagattggactggcaaccggtgaaccgccaacaagtaaaggt
tatactccttctgtatttactacactgccaaaattactggaacgtagtggtacttcgcaa
tttggatcaattactgctttttatactgtacttgttgaaggtgatgatatgaatgaacca
attgccgattcggttcgaggcatcttagatggacatatcattttatccagaaaaatcgct
tcggaaaatcattatccggcaatagatattcctaatagtttaagtcgattaatgaaagaa
ctcgtttccccagagcaagatgaattagctggtaaattaagagaaaatttaacgagatat
tctgactccaaagatttaatagatgtaggagcatatcaaaaaggatcaaatcctttagta
gatcaggcagtcagacttaatcgaccaatcaaagagtttttaaaacagaaaacgactgaa
gagtataaatatgaggaaacattggaagaattaaaatctgtattttctgctcagccgcta
agataa

DBGET integrated database retrieval system