KEGG   Marinobacterium aestuarii: A8C75_04810Help
Entry
A8C75_04810       CDS       T04398                                 

Definition
(GenBank) anthranilate 1,2-dioxygenase small subunit
  KO
K05600  anthranilate 1,2-dioxygenase (deaminating, decarboxylating) small subunit [EC:1.14.12.1]
Organism
mars  Marinobacterium aestuarii
Pathway
mars00627  Aminobenzoate degradation
mars01100  Metabolic pathways
mars01120  Microbial metabolism in diverse environments
Module
mars_M00637  Anthranilate degradation, anthranilate => catechol
Brite
KEGG Orthology (KO) [BR:mars00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    A8C75_04810
Enzymes [BR:mars01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.1  anthranilate 1,2-dioxygenase (deaminating, decarboxylating)
     A8C75_04810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ring_hydroxyl_B SnoaL_4 SnoaL_2
Motif
Other DBs
NCBI-ProteinID: ANG61870
UniProt: A0A1A9EVU4
LinkDB All DBs
Position
1095749..1096237
Genome map
AA seq 162 aa AA seqDB search
MNPTLHSIEQFLYQKAELCDRQQWDEYLALFDEDAEFHMPQWESEHVHTTNPRREMSLIY
YPSRAGLEDRVFRIRTGKSAACTPMPRTLHLVSNVQAQPQDDGSWLVKANWATHFYRFGE
AEVFFGRVEYRLRAEGDSFRIRRKQVVLLNDKIRHVLDFYHV
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgaccttgcacagcattgaacagtttctgtaccagaaggccgagctctgtgat
cgtcagcagtgggatgaatacctggcgctgtttgacgaggacgccgagtttcatatgccg
cagtgggagtcggagcatgtccacaccacaaatcccagacgggaaatgtcactgatttac
tacccgagccgtgccgggcttgaagatagggtatttcgcattcgcaccggcaaatcggcg
gcctgtacccccatgccgcgcaccttgcaccttgtcagcaatgtacaggcacagccgcag
gatgatggcagctggttggtgaaggccaactgggcgacccatttttaccgctttggcgag
gccgaggtgttctttggccgggtcgaataccgcttgcgcgccgagggcgacagctttcgt
atccgcaggaagcaggtggtgctgctgaacgacaagattcgccacgtactggacttctat
cacgtctga

DBGET integrated database retrieval system