KEGG   Marinobacterium aestuarii: A8C75_07500Help
Entry
A8C75_07500       CDS       T04398                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
mars  Marinobacterium aestuarii
Pathway
mars00020  Citrate cycle (TCA cycle)
mars00190  Oxidative phosphorylation
mars00650  Butanoate metabolism
mars01100  Metabolic pathways
mars01110  Biosynthesis of secondary metabolites
mars01120  Microbial metabolism in diverse environments
mars01130  Biosynthesis of antibiotics
mars01200  Carbon metabolism
Module
mars_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mars_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mars_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mars00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A8C75_07500
   00650 Butanoate metabolism
    A8C75_07500
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    A8C75_07500
Enzymes [BR:mars01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     A8C75_07500
    1.3.5.4  fumarate reductase (quinol)
     A8C75_07500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA FAD_binding_3 DAO Thi4 HI0933_like Pyr_redox_3 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ANG62349
UniProt: A0A1A9EXU1
LinkDB All DBs
Position
1678523..1680295
Genome map
AA seq 590 aa AA seqDB search
MTKLRTLTFDAIVVGGGGAGMRAALQLAQSGLNTACVTKVFPTRSHTVSAQGGITCAIAS
ADPNDDWRWHMYDTVKGSDYIGDQDAIEYMCSVGPQAVFELDHMGLPFSRTEIGRIYQRP
FGGQSKNFGEGGQAARTCAAADRTGHALLHTLYQGNLKAGTVFLNEWYAVDLVKNAEGAV
VGCIAICIETGETVYIKAKATVLATGGAGRIYASTTNALINTGDGMGMALRAGVPAQDME
MWQFHPTGIAGAGVLVTEGCRGEGGYLVNKDGERFMERYAPNAKDLAGRDVVARSMILEL
LDGRGCGPDGDHVFLKLDHLGEEVLHSRLPGICELAKTFAAVDPVKEPIPVVPTCHYMMG
GVPTNIGGQAIGMDAEGNDCIIDGLFACGEVACVSVHGANRLGGNSLLDLVVFGRAAGIQ
IEKQLQEGYECLDATDADIEAAMSRLNRLNNSTGGESVAEVRKDLQSTMQLYFGVFRDGG
SMQKGLELLKGLRERVGNLNLEDKSGAFNTARIEALELENLMEVAEATAIAAEVRKESRG
AHARNDFTERDDENWLCHSLFHPVDKRITKRAVNFAPKTMEAFPPKIRTY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgactaagctgcgtacgctaactttcgacgcaattgtagtcggtggcggtggtgcgggt
atgcgtgcagcactgcagctggcccagtccggtttgaatacggcctgtgtcaccaaggtg
ttcccgacccgctcgcacacggtatccgcccagggcggcattacctgtgcaatcgccagt
gccgatccgaacgacgactggcgctggcacatgtacgataccgtcaagggctccgattac
atcggtgaccaggatgcgatcgagtacatgtgttctgtcggtccccaggcggtgtttgag
ctggaccacatggggctgccgttctcccgtacggaaatcggccgtatctatcagcgtcct
ttcggcggtcagtcgaagaacttcggtgaaggtggtcaggctgcacgtacctgtgccgcg
gctgaccgtaccggtcacgcgctgctgcacacgctgtatcagggcaacctgaaagcgggc
accgtgttcctgaatgaatggtacgccgttgatctggtgaaaaatgccgaaggcgctgta
gtcggctgtatcgccatctgcatcgaaaccggcgaaaccgtttacatcaaggccaaggcc
actgttctggctaccggcggtgcgggtcgcatctatgcgtccaccaccaatgccctgatc
aataccggtgacggtatgggcatggcgctgcgcgcaggcgtgccggcccaggatatggaa
atgtggcagttccatccaaccggcatcgccggtgccggtgtgcttgtgacagaaggttgc
cgcggtgaaggtggctacctggtcaacaaggacggcgagcgcttcatggagcgttatgcg
cccaatgccaaggaccttgcaggccgtgatgttgttgcccgttccatgattctggagctg
ctcgacggtcgtggctgtggcccggacggcgatcacgtcttcctgaaactggatcacctg
ggtgaggaagtgctgcactcccgtctgcccggtatctgtgagctggccaagacctttgcg
gccgtggatccggtgaaagagccaatcccggttgttccgacctgccattacatgatgggt
ggcgttcccaccaacatcggcggtcaggcgatcggtatggatgctgagggcaatgactgc
atcatcgacggactctttgcctgtggcgaagtggcctgcgtatcggtacacggtgctaac
cgtctgggcggcaactcgctgctggatctggtggtattcggtcgtgcagccggtattcaa
atcgagaagcagctgcaggaaggctatgaatgcctggatgcgactgatgctgatatagaa
gcggccatgtcgcgtctgaatcgcctcaataacagcaccggcggcgaaagcgtggctgag
gttcgcaaggacctgcagagcaccatgcagctgtacttcggcgtgttccgcgatggcggc
agcatgcagaaaggtctggagttgctcaagggtctgcgcgaacgcgttggcaatctcaat
ctggaagacaagtccggcgccttcaataccgcgcgtatcgaagctctggagcttgaaaac
ctgatggaagtggctgaagcgactgccattgctgccgaggtccgcaaggaatcccgcggt
gcgcatgcgcgtaacgacttcactgagcgtgatgacgagaactggctgtgtcactccctg
ttccatccggtcgacaagcgcatcaccaaacgtgcggtgaactttgcgcccaagaccatg
gaagcttttccgccgaaaatcagaacgtactaa

DBGET integrated database retrieval system