KEGG   Marinobacterium aestuarii: A8C75_07505Help
Entry
A8C75_07505       CDS       T04398                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
mars  Marinobacterium aestuarii
Pathway
mars00020  Citrate cycle (TCA cycle)
mars00190  Oxidative phosphorylation
mars00650  Butanoate metabolism
mars01100  Metabolic pathways
mars01110  Biosynthesis of secondary metabolites
mars01120  Microbial metabolism in diverse environments
mars01130  Biosynthesis of antibiotics
mars01200  Carbon metabolism
Module
mars_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mars_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mars_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mars00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A8C75_07505
   00650 Butanoate metabolism
    A8C75_07505
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    A8C75_07505
Enzymes [BR:mars01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     A8C75_07505
    1.3.5.4  fumarate reductase (quinol)
     A8C75_07505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: ANG62350
UniProt: A0A1A9EX74
LinkDB All DBs
Position
1680308..1681012
Genome map
AA seq 234 aa AA seqDB search
MLVSVYRYNPETDDAPYMQDIHIDIPGGKDIMVLDLLQLLKDKDPSMAYRRSCREGVCGS
DGMNMNGKNGLACITPLSAVVEKDKLVLRPLPGLPVVRDLVVDMGQFYKQYEKIKPFLIN
DTPAPAIERLQSPEERAELDGLYECILCACCSTACPSFWWNPDKFVGPSGLLQAYRFLAD
SRDTATRERLAELDDPFSVFRCHGIMNCVSVCPKGLNPTKAIGKIRNMLLQQAT
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgctggtaagtgtatatcgctacaatcctgagactgacgatgcgccttacatgcaggat
atccatatcgatatccccggtggcaaggacatcatggtgctggatctgcttcagcttctg
aaggacaaggacccgtccatggcctaccgtcgctcctgccgtgaaggcgtgtgcggctca
gatggcatgaacatgaacggcaagaatggtctggcctgcatcacgccgctgtctgcggtg
gtggaaaaggacaaactggttctgcgcccgctgccgggtctgccggttgtgcgtgacctg
gtggtcgacatgggtcagttctacaagcagtacgagaagatcaagccgttcctgatcaat
gatacgccggcaccggcgatcgaacgtctgcagtcgccggaagagcgcgctgagctggac
ggtttgtacgagtgtattctctgtgcatgctgctccactgcctgtccgtccttctggtgg
aatccggacaagtttgtcggaccttccggtctgttgcaggcttaccgcttcctggcggac
agccgtgatacggcaacccgggagcgtctggcggagcttgatgatccgttcagcgtcttc
cgctgccatggcatcatgaactgtgtcagcgtttgtcccaaggggctcaaccccaccaag
gcaatcggcaagatccggaatatgttgctacaacaggcgacctga

DBGET integrated database retrieval system