KEGG   Marinobacterium aestuarii: A8C75_12010Help
Entry
A8C75_12010       CDS       T04398                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mars  Marinobacterium aestuarii
Pathway
mars00250  Alanine, aspartate and glutamate metabolism
mars00410  beta-Alanine metabolism
mars00430  Taurine and hypotaurine metabolism
mars00650  Butanoate metabolism
mars01100  Metabolic pathways
mars01110  Biosynthesis of secondary metabolites
mars01120  Microbial metabolism in diverse environments
mars02024  Quorum sensing
Module
mars_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mars00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A8C75_12010
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A8C75_12010
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A8C75_12010
   00430 Taurine and hypotaurine metabolism
    A8C75_12010
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    A8C75_12010
Enzymes [BR:mars01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     A8C75_12010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS OKR_DC_1 Aminotran_1_2 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ANG63125
UniProt: A0A1A9EZ05
LinkDB All DBs
Position
complement(2737297..2738946)
Genome map
AA seq 549 aa AA seqDB search
MNKNSKAAAVSMENLLRIFTVPEAPGSTLSRLENDISANLAGFLQDHIVAEETDLVKIER
DFSDSLIPEQPVYVSEQAQFLLDKVVAQSVHTSSPSFVGHMTSALPYFMIPLSKIMIALN
QNLVKTETSKAFTPLERQVLGMLHRLVYEQPDEFYDRWLHDSHHHLGAICSGGTVANITA
LWAARNRAFGPDGDFPGITRSGVFAAMRHYGCEGMAVLVSERGHYSLSKAADVLGIGRDQ
IVAVETDGQNRIRPDALRAKLKQLQQQNIRPFALVGVAGTTETGNIDPLDQLADIAEEHG
IHFHVDGAWGAPTLFSERYRGRLKGIERADSVTIDAHKQLYVPMGVGLVLFRDPSALSSI
EHHAQYIIRKGSKDLGSATLEGSRPGMAMLVHSALKIIGRRGYAMLIDNGIELAQRFADR
IESLDDFELVSAPELNILTYRWVPAQVQAALRDADVARSIEINEVLSRITRIIQKTQREL
GKAFVSRTRLTPDRYAHHAITVFRVVLANPLTTDEVLCYVIDEQREIVSTLADSEDFVEL
ARLTSASTD
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgaataagaattcgaaggcagccgcggtcagcatggaaaacctgttgcggattttcacg
gttcccgaagcccctggctcaaccctgagccggctggagaacgatatttccgccaacctt
gccggttttctgcaggatcatatcgttgcagaagagacggacctggtcaaaatcgagcgg
gatttcagcgacagcctgatccccgaacagccggtgtatgtttccgagcaggcacagttc
ctgctcgacaaggtggtggcgcagtcggtgcatacctcatcgcccagctttgtcggccac
atgacctcggccttgccgtatttcatgatcccgctgtccaagatcatgatcgcgctgaac
cagaacctggttaaaaccgaaacctccaaggcctttacgccgctggagcgtcaggtgctg
ggcatgctgcaccgtctggtgtacgaacagccggatgaattctacgaccgctggctgcat
gacagccaccatcacctgggcgccatttgttccgggggcaccgtcgccaacatcaccgcg
ctctgggcggcgcgcaaccgtgcctttgggcccgatggcgacttccccggcatcacccgc
agtggtgtcttcgccgccatgcgccactacggctgtgaaggcatggcggtgctggtgtcc
gagcgcggccactattcgctgtccaaggcggccgatgtgctggggataggccgtgatcag
attgtggccgtggaaacggacggccagaaccggattcgcccggatgcgctgcgggccaag
ctcaagcagctgcagcagcagaatatccgcccctttgcgctggtcggtgtggccggtacc
accgagaccggcaatatagatccgctggaccaactcgccgatatcgccgaagaacatggc
attcacttccatgtggacggtgcctggggtgcacccacgctgttttccgagcgttatcgc
gggcgtctcaagggcattgagcgggcagactccgtgaccatcgatgcccacaagcagctg
tatgtgcccatgggcgttggtctggtgttgttccgcgatccttcggcgctgagcagtatc
gagcatcatgcccagtacattattcgcaagggctccaaggaccttggcagcgcgaccctt
gagggctcgcgcccgggcatggcgatgctggtgcattcggcgctgaagattatcggccgc
cgcggctatgcgatgctgatcgacaatggcatcgagctggcacagcgctttgccgatcgc
atcgagtcgctggatgatttcgagctggtctcggcgcctgagctgaacatcctgacctat
cgctgggtgccggcccaggtgcaggcggcactgcgggatgccgatgtcgcgcgcagcatc
gagatcaatgaggtgctcagccgcattacccgcatcattcaaaagacccagcgtgaactg
ggcaaggccttcgtctcccggacccggctgacgccggaccgctacgcccaccatgccatc
actgtgtttcgggtggtgctggccaatccgctgaccaccgatgaagtgctgtgctatgtg
atcgacgagcagcgcgagattgtcagcaccctggctgacagcgaagattttgtcgagctt
gcgcgcctgacctctgcttccactgactga

DBGET integrated database retrieval system