KEGG   Maribacter sp. T28: BTR34_03475Help
Entry
BTR34_03475       CDS       T04597                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mart  Maribacter sp. T28
Pathway
mart00620  Pyruvate metabolism
mart00680  Methane metabolism
mart01100  Metabolic pathways
mart01120  Microbial metabolism in diverse environments
mart01200  Carbon metabolism
Module
mart_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mart00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BTR34_03475
  Energy metabolism
   00680 Methane metabolism
    BTR34_03475
Enzymes [BR:mart01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BTR34_03475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: APQ16450
UniProt: A0A1B7ZBB9
LinkDB All DBs
Position
complement(799374..801920)
Genome map
AA seq 848 aa AA seqDB search
MQQKERLAEFKKSVQNKFNVYNSLFLNLPYKDIDDVGMLIPLLLNQSEKGLSNGLNPKEI
LENFFENFVEIKSEKEQIDFMFRIIQYVERQVVLYDSVEDAAFPKLQKHSSSLSLKDYFQ
LVEKNNSWDTIWDKLSNFSARIVLTAHPTQFYTPAVLDIITNLRTLILEDKIDEIDVGLQ
QLGLTSLINAKKPTPLDEAKNIIYTLRHVYYDAIGDMYAYIKGSVGSKIFENHDIVKLGF
WPGGDRDGNPFVTADITRDVMNELRLTLMKCYYNDLKGLVHKLTFKDVQEPLQKLRSNLY
IAMFDSSKDIGYDDLILPLEEIRLILIEKYQGLYLNDLERFIDKVKIFKVHFATIDIRQD
HSMHTKVMVEVLKKNGFIKKELSELSDDKLIDILLHENLELVADDYEEDIVKDTIKNILQ
LQTIQAKNGQEGCNRYIISNSEDIFSILFVYGLFRWCGWANKEITFDIVPLFETMIGMDS
AQETMQFLFNLPEYKAHIKNRNNKQTIMLGFSDGTKDGGYLKANWSILKTKEELSEVCDE
HGIAAIFFDGRGGPPARGGGKTHRFYAAQTNKVANNEIQLTIQGQTITSTYGTKEQFIYN
SEQLLTAGLSNTILGKEIVISDSDRKLIEELSDMSFKKYDDLKHHDKFMPYLENMSTLKY
YTKANIGSRPGKRGNKAKLELSDLRAISFVGSWSQLKQNVPGYYGIGTALKNLEDDGRFS
EVQRLYKEVPFFQALMMNSMMSLSKCYFELTSYMKENKEYGAFWEILHAEYKLSKAMLLK
LSGMEILMQKEAISRESIKIRENIVLPLLVIQQYALQRIGEGTEYKELYEKIVTRSLYGN
INASRNSA
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaaaaagaaaggttggcagagtttaaaaaatctgtccagaataagtttaatgtt
tataatagtctttttttaaatctaccttacaaagacattgatgacgtgggtatgttaata
ccgttattactaaatcaatcagaaaaagggttaagtaacggtcttaatccgaaggaaatt
cttgaaaattttttcgagaattttgtagaaataaaatctgaaaaagaacagatagatttt
atgtttcgcattatacaatatgtggaacgtcaagttgtactttatgatagtgtggaagat
gcagcgtttcctaagttgcaaaagcattctagttccttgtcgttgaaagattattttcaa
ttggtagaaaaaaataattcatgggacaccatttgggataagctaagcaactttagtgca
agaatagtattaacagctcacccaacacaattttacactcctgctgttttagatattatc
accaatctaagaactttgattttggaagataaaattgatgaaatagacgttgggttacaa
caattagggcttacctctttaataaatgcgaagaagccaacacctttagatgaggccaag
aatattatttatacattaagacatgtatattatgatgctattggagacatgtatgcatat
ataaaaggtagtgtagggtcaaaaatttttgagaatcacgatatagtaaaattaggattt
tggccaggaggtgatcgcgatggtaacccttttgttacagcagatattacaagagatgta
atgaatgagcttcgtttaaccttaatgaagtgttattataatgatttaaaaggacttgtc
cataagcttacgtttaaagatgtacaagagcctttacaaaagttacgttctaatttatac
atcgccatgttcgatagttctaaagatattggctatgacgacttaattttgcctttagaa
gaaattagattaatactcattgaaaaatatcaaggtctatacttaaatgacttagagcgc
tttattgataaggtaaagatttttaaagtacattttgctactattgacattcgtcaagac
cacagtatgcacaccaaagtaatggtagaagtgcttaaaaagaatggttttataaaaaaa
gagcttagcgagttgtccgacgataaacttatcgatattcttttacatgagaatttagaa
ttagtagcggatgactatgaagaagacattgtaaaagataccattaaaaatattctacaa
ttacaaactatacaggccaaaaatgggcaggaaggatgtaatagatatatcattagtaat
tctgaggatattttctctatactttttgtgtatggattatttagatggtgtggttgggca
aataaagaaataacttttgatatagttccgttgtttgagacaatgattggtatggatagt
gcacaagaaaccatgcagtttttgtttaatttacctgagtataaagcacatataaaaaat
agaaataataagcaaacgataatgcttggtttttctgatggtacaaaagatggtggctat
ttaaaagcaaactggtcaattttaaagactaaagaagaattgtcagaagtttgtgatgaa
catggcatagctgctatattttttgatggtaggggaggaccgccagcaagaggtggaggt
aaaacacaccggttctatgctgcccaaacaaataaagttgccaataacgaaattcaatta
accatacaagggcaaacaataacgagtacgtatggtacaaaagagcaatttatttataac
agtgaacaattgttaactgctggtttatctaataccattttaggtaaggaaattgtaatt
tcagattcggataggaagttgatagaagaactttctgatatgagttttaaaaaatatgat
gacttaaagcatcatgataagtttatgccatatttggaaaatatgagcacacttaagtat
tatacaaaagccaatattggtagtagacccggaaaaagaggaaacaaggccaagttggag
ttgtcagatctacgtgccatttcttttgtaggttcttggagccagttaaaacaaaatgta
cctggatattatggtattggtacagcattaaaaaacttagaagatgatggtagatttagt
gaagtgcaaagactttataaagaagtaccattttttcaagcattaatgatgaatagtatg
atgagtttatccaaatgttattttgaattgacaagttacatgaaggagaataaagaatat
ggcgcattttgggaaatactccatgctgagtataaactttcaaaagcaatgttgttaaaa
ttatctggtatggaaattttaatgcagaaagaagctatttctagagaatccattaaaatt
cgtgagaatatagtattgccattattggtaatacagcaatacgcgttacaaagaataggt
gagggtaccgagtataaagagttatatgagaaaattgtaaccaggtctctttacggaaat
attaatgctagtagaaattcagcatag

DBGET integrated database retrieval system