KEGG   Maribacter sp. T28: BTR34_03755Help
Entry
BTR34_03755       CDS       T04597                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
mart  Maribacter sp. T28
Pathway
mart00380  Tryptophan metabolism
mart01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mart00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    BTR34_03755
Enzymes [BR:mart01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     BTR34_03755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: APQ16499
UniProt: A0A1B7Z6A4
LinkDB All DBs
Position
complement(871219..872487)
Genome map
AA seq 422 aa AA seqDB search
MEFKNTLEFAQSLDAKDNLKSYRDEFFFPKIKGKEVIYFTGNSLGLQPKRTKAFVDEVMK
DWGELAVEGHFYAEKPWWDYHERLAKPLAKVVGALPEEVSVMNTLTVNLHLLMVSFYNPT
KTRFKILCEEKAFPSDQYMFQSQVRFHGLDPDETIVELKKRDGENHWRTEDILETIEELG
DELALVLIGGVNYYNGQVMDMKAITKTGKAVGANVGWDLAHAVGNVELKLHDWDADFASW
CSYKYMNSGPGNASGIFVNKRHLNKKDIQRFEGWWGTKKETRFLMKPEFEPMENADAWQI
SNVPVLSVAPYLASLTMFEEVGMAKLIEKRNLIVSYLEFILHEIDKEVDSSFEIITPKDR
GCQLSVFLHGQGKSLFNYLMENGVVTDWREPNVIRLAPAPFYCSYEDMYRFGQILKSGVL
AN
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggaatttaagaatacgttggaatttgctcaatctttagatgctaaggataacttaaaa
tcatatagagatgaatttttttttcctaaaatcaaagggaaggaagtcatttattttaca
ggaaattcattaggtctacagccaaaacgtaccaaggcattcgttgatgaggtgatgaag
gattggggagaactagccgtggaaggtcatttttatgctgaaaaaccttggtgggattat
catgagcgacttgcaaaacctttagcaaaagtagtaggcgcattgccagaagaagtatct
gtgatgaataccttaacggttaatcttcatttattaatggtttctttttacaaccctaca
aaaacacgatttaaaattttatgtgaagaaaaagcatttcctagcgatcaatatatgttt
caaagtcaagtgcggtttcatggcttagatccagacgaaactatagtagaacttaaaaaa
cgagatggtgaaaatcactggcgtacggaagatattcttgaaaccattgaggaattagga
gatgaattagccctagtcttaattgggggcgttaactattataacggtcaagtgatggat
atgaaagccattacaaagacggggaaagctgtaggtgccaatgtgggttgggatttagcc
catgccgtgggtaatgtagaattaaaactacatgactgggatgcagattttgcctcgtgg
tgtagttacaagtatatgaatagtggtccaggtaatgcttcgggtatattcgtaaacaag
agacatctaaataaaaaagacattcagcggtttgaaggttggtggggaaccaaaaaggaa
acccgttttttaatgaaaccggagtttgaacctatggaaaatgccgatgcatggcaaatt
agtaatgtacctgtactatcggtagcaccatatttagcatcgctgaccatgtttgaagaa
gtaggaatggcaaaattgattgaaaaaagaaatttaatcgtatcctatttagaatttata
ttacatgaaatagataaagaagttgatagttcttttgaaattataacccccaaagataga
ggctgccagttgtccgtatttttgcacggccaaggaaaatctttgtttaattatttaatg
gaaaacggggtggtgacagattggcgcgagccaaatgtaattcgtttggccccagcacct
ttctattgctcgtatgaagacatgtaccgttttgggcaaattttgaaatcaggagtatta
gcaaattga

DBGET integrated database retrieval system