KEGG   Mahella australiensis: Mahau_0989Help
Entry
Mahau_0989        CDS       T01494                                 

Definition
(GenBank) serine/threonine protein kinase with PASTA sensor(s)
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mas  Mahella australiensis
Brite
KEGG Orthology (KO) [BR:mas00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mas01001]
    Mahau_0989
Enzymes [BR:mas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Mahau_0989
Protein kinases [BR:mas01001]
 Serine/threonine kinases: Other
  Bacterial family
   Mahau_0989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like Pkinase_fungal FTA2 KIND Seadorna_VP7 RIO1 ABC1 Kdo
Motif
Other DBs
NCBI-ProteinID: AEE96187
UniProt: F4A2E0
LinkDB All DBs
Position
1025838..1027778
Genome map
AA seq 646 aa AA seqDB search
MDALIGKILGGRYEIVEKIGEGGMAVVYRAHCHLLSRDVAVKILRPEYANNEEFIRRFRK
EAQAAASLSHHNIVNIYDIGNDNNLRYIVMEYIDGPTLKDIIKRDAPLAYERAVNIAIQI
CAALDHAHKHGIIHRDIKPQNIMLTADGVVKVADFGIAKAVADVSTTLYDTDTMGSVHYL
SPEQARGGYVDAKSDIYSLGVVLYEMVTGQVPFTGDTAVAVALKHLHDDIRSVRELNPDV
PPALDQVITKALQKDRDQRYDSAMEMMVDLRRVLREPYGTFVSISDSMVDEPTRVVPAIH
ERDHDKPQPSAEERPAKKVWKVVIIAVAIIAIMAAGAATAMRIYNDYFAVPDVNVPSIVR
QEENAARQQLESLGLVMNVVDRQYNDEVPEGYIISQDPQPNTTVKKGASVNVIVSQGTKN
IEVPSIVNKTETEAKLILEEAGLEPGEVRHSYSDEYPAGYVMDQNPKAGIHVTGDNIKVD
YVVSDGPETTTITLPDFEGQLLDDAQKVLESYGLKIGRIVREDSSYDKDVILRQKPEPQT
QVTEGSTVDFWVSSGKPKIYSPKQITIPLPQDWLDPEDPEKPAEQLTIKVLKKEGDVTEV
VYQGVHKPSEKEIKINVEGKSKAVVEVYIFDQLYKSIEIDFTKEAS
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggatgcattaatcggtaaaatattgggtgggcgctatgaaatagtggagaagataggc
gaaggtggcatggcggtggtgtatagagcacactgtcatctgcttagccgcgatgtggcg
gtgaaaatcctaaggccggagtatgccaacaatgaggaattcataaggcgttttagaaaa
gaggcacaggctgctgcttcgctttctcatcataatatagtcaatatatacgatataggc
aatgataataacctaagatatatagttatggaatatatagacggccctacacttaaggat
attataaaacgagacgctcctttagcatatgagagggctgtaaacatagccatacagata
tgcgcggcattggatcatgcccataagcacgggataatacacagggatataaaacctcag
aatataatgcttaccgctgatggtgtggtcaaggtagccgatttcggcatcgctaaagcc
gtggctgatgtttctactaccttgtacgacaccgataccatgggatcggtgcattatcta
tcgccggagcaggctcgtggcgggtatgtcgatgccaagtcggatatatattcgctgggt
gtggtactctatgagatggtgacgggccaggtgccgttcacaggtgataccgctgtagcg
gtagcgcttaagcatttacatgatgatataagatcggttagagagcttaatccagatgta
ccgccggcgttggatcaagttataacaaaagctttgcaaaaggacagggatcaacgctac
gacagtgctatggagatgatggtggatttgcggcgtgtactgcgcgagccatatggtacc
ttcgttagcattagcgactccatggtcgatgaacctacgcgagtagtgcctgctatacat
gagcgcgatcatgataaaccacagccttctgctgaagaacgtcccgctaagaaagtgtgg
aaggttgttatcatagcggttgctattattgccattatggcggccggcgcagcgacggct
atgaggatatataacgattattttgccgtacctgatgtaaatgtgccatctatagtgcgt
caggaagaaaatgctgctagacagcaattagaatctcttggattagttatgaatgttgtt
gatcgccagtataatgatgaagtgccggagggatatataatttcacaagacccccagcca
aatacaacggtaaaaaagggggcttcggtaaatgttattgtaagtcagggaactaagaat
atagaggtgccatctatagtaaacaaaaccgaaaccgaagcgaaattaatattagaagaa
gcagggttagagccgggtgaagtaaggcatagctacagcgatgaataccctgccgggtat
gttatggaccagaatccaaaagcaggtatacacgtaactggagacaatataaaggtggat
tacgttgtgagcgatggcccagagacaaccactataacgctgccggattttgagggacag
cttttggatgatgctcaaaaagtgctggaatcatacggccttaaaatcgggcgtatcgtc
agggaagacagctcatatgacaaagatgttatattaaggcaaaagccggaaccacaaact
caagtgaccgaaggcagtacggtagacttctgggtgagcagtgggaagccgaagatatac
tcgcccaagcagataacaatacctctgcctcaggactggctggacccagaagacccggaa
aagcctgctgaacaacttactataaaggtgcttaaaaaggaaggcgatgtaacagaggtt
gtctatcaaggggttcataagccttccgaaaaggaaataaaaataaatgtggagggtaag
agcaaagctgtagtggaggtatatatattcgatcaactttataaaagcatagaaatagat
tttaccaaggaggcttcatga

DBGET integrated database retrieval system