KEGG   Mahella australiensis: Mahau_2727Help
Entry
Mahau_2727        CDS       T01494                                 

Definition
(GenBank) flagellar hook-associated 2 domain-containing protein
  KO
K02407  flagellar hook-associated protein 2
Organism
mas  Mahella australiensis
Pathway
mas02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:mas00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    Mahau_2727
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:mas02035]
    Mahau_2727
Bacterial motility proteins [BR:mas02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    Mahau_2727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FliD_C FliD_N RuvC
Motif
Other DBs
NCBI-ProteinID: AEE97863
UniProt: F3ZZ81
LinkDB All DBs
Position
2891844..2893778
Genome map
AA seq 644 aa AA seqDB search
MYMNPINTFRVSGLASGIDTESIVKQLMTVERLPLDRLKQNRQIIEWTQAAYRDMNSALL
AFRNQVSNMRLQGNFLANKVMSSNESVATATASGSATGSVYDINIDQLAASAKAISTDGI
SNLKSVLTGQGITASVTIDSSSNSFHLKVGSNTAVITLAEGAYNTAGGLAAAIQAAINAK
ASELGIAEDAIKVYATPDNKLRFVSDSSIKFELTPTDTNNALSKLGFDVPAGSSIKSTVQ
GVDINTPINQMIREGRLVGVSAPYADNLDFSITTYNQEGTAISQTFTIDPNTQSLQDVIS
AIQNSGLGLTGFYDAASDKIAFTSKYTGNNNAAGADIEFGGDDADFLNNVMKFGIVNETK
RGVTDGQDASFTINGLTTSRKSNTFALNGVTFTLKSAGAATISVQQDTDAIVNKIKDFVT
QYNDIMDKVNSALTEKRYRNYLPLTDEQKDAMSDKEIEKWEEKAKSGLLNGDSILYKSFY
DMRNAISRPVEGVNGSLNSMSKLGITSGLWYENGRLYIDEAKLRDAVSNDPSGVMELFTK
TSTATDKTQAFNESGIAQRLYNIVNNTIKAITDKAGQSNSLFKVDNSVLGLQMKDMDNRI
SDMEQRLTDIENRYYRQFTAMEQALNQMNAQSAWLVQQLAASQR
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgtatatgaatcctataaatacatttagggtaagcggcctggcatctggcatagacaca
gaaagcatagtgaagcagctcatgacggtcgagcgcctgcctttggaccgcttaaaacaa
aaccgacagataatagaatggacgcaggcggcgtatcgagatatgaacagcgcattattg
gcctttcgcaatcaggtgtccaacatgcgcctgcagggcaactttctagcaaataaagtt
atgtcgtcaaacgaatcggtggcaacggctacggcaagcggatcggccaccgggtcggtg
tatgatataaatatcgatcaattggcggcgtcggccaaggctataagcaccgacggcata
tccaacctaaagagcgtgctgacaggtcagggcataaccgcttctgtaaccatagattca
tcgtctaattcattccatctcaaggtcggctccaatactgctgttataacgcttgcagaa
ggcgcttataacaccgcaggcggccttgcagcggccatacaggcagccataaatgcaaag
gcatcggaactcggcatagcggaagatgctataaaagtatatgcgacacccgataacaaa
cttcgatttgtatccgattcatccatcaaatttgagcttacgccgaccgatacaaataac
gctttgagcaagctcggcttcgacgtgcccgccggcagctcgatcaagtctactgtccaa
ggcgtggatataaacacccctataaatcagatgataagggaaggtcgactggtaggcgta
tcagccccatacgcagacaatctcgacttctccataaccacatacaatcaggagggtacg
gctataagccagacctttaccatagaccctaatacgcagagcctgcaggacgtcatatcg
gccatacaaaattccggcttaggcctaaccgggttttatgatgcggccagcgataaaata
gccttcacatcaaaatataccggaaacaataatgctgctggcgcagatatagaattcggc
ggtgacgatgcagattttcttaacaatgtcatgaagtttggcatagtaaatgaaaccaaa
cgtggcgtgaccgatggccaagacgcctcgttcaccataaacggcctgactacgtcgcgc
aaaagcaatacattcgccttaaacggcgtcaccttcacgctcaagagtgctggagcagcc
accatatcggtgcagcaggataccgatgccatagtgaataagataaaggatttcgtaacg
caatacaacgatataatggataaggtcaattcggcgctgactgaaaagcgctacaggaat
tatctcccgctcaccgatgagcaaaaggatgccatgagcgataaggaaatagaaaaatgg
gaggaaaaagccaaaagcggcttactaaacggcgacagcatactatataagtcattctac
gatatgcgaaacgccatatcccgtcccgtagagggcgtaaacggttcacttaattctatg
tcaaaactaggcataacatctggtctatggtatgagaatggccgcctttatatagatgaa
gccaagctgcgtgatgccgtatccaacgatcctagcggcgttatggagctttttaccaag
acgtccaccgccactgataaaacgcaggccttcaacgaatccggcatagcccagcgttta
tacaatatagtaaacaacactataaaagctatcactgataaagccggtcaaagcaacagt
ttattcaaagtggacaacagcgtattgggtttgcagatgaaggatatggataaccgcata
agcgatatggaacagcgcctaacagatattgagaaccgctattacagacaatttacggct
atggagcaggcattgaatcaaatgaatgcccagagcgcatggctggttcaacaattagct
gcatctcaacgataa

DBGET integrated database retrieval system