KEGG   Massilia violaceinigra: CR152_04555Help
Entry
CR152_04555       CDS       T05157                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
mass  Massilia violaceinigra
Pathway
mass00550  Peptidoglycan biosynthesis
mass01100  Metabolic pathways
mass01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:mass00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CR152_04555
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CR152_04555
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mass01003]
    CR152_04555
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mass01011]
    CR152_04555
Enzymes [BR:mass01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     CR152_04555
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CR152_04555
Glycosyltransferases [BR:mass01003]
 Polysaccharide
  Bacterial polysaccharide
   CR152_04555
Peptidoglycan biosynthesis and degradation proteins [BR:mass01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   CR152_04555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: ATQ73870
UniProt: A0A2D2DFX2
LinkDB All DBs
Position
complement(991222..993573)
Genome map
AA seq 783 aa AA seqDB search
MSSSKPDANPSSPSRPARARSPKRLLLIVLGSLTGTALIGLLVVVFALAMAYPNLPPLDT
LTDYRPKMPLRIFSADNVLIGEFGEERRNLVHIKDIPEVMKKAVLAIEDDRFYQHGGVDY
TGILRAALHNATGGAKQGASTITQQVARNFFLSSEQTLKRKAYEVLLAWKIEQNLTKDQI
LEVYMNQIYLGQRAYGFASAAQIYFGKNLKDITVAEAAMLAGLPKAPSAYNPVVNPKRAR
TRQQYILQRMHMLGYITTPQFETAKAETLRIKTDSSEFGVHAEYVAEMARQLVYEQFKEE
TYTRGLNVFTTITKADQDAAYLALRRGVMEYERRHPYRGPESYIEIPQAKEEADEAIENA
LAEHPDSDDIIAAMVLQASPTGITAVTASGEEVKISGTGLAFAQNWLSSKAPANRRVKRG
AVIRISQDGGTAWSVTQMPEVQSAFVAADATDGAIRALVGGFDYNRNKFNHVTQAWRQPG
SSFKPFIYSASLERGLSPATIINDAPISFDAGQTGGQAWEPKNYDNKYEGPMTMRRGLTK
SKNMISIRILNKIGAKYGQEYTTRFGFESEKNPPYLTLALGAGSTTPLQLAGAYAVFANG
GFRVSPYLISKVTDSSGKILSQATPDKSGDEANRVIDARNAFLVDSMLKDVVRFGTATKA
LSLKRTDISGKTGTTNDSIDAWFAGYTPKLVGIAWIGYDQPKNLGNKETGGGLALPIWIG
YMQKALKGVPNEERAVPEGLVMAGDDYYYVENPPGTGVQSLDIGARGTPAEEKVKDAVKN
ELF
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgagctcttccaagccggacgccaacccctcttccccgtcgcgccctgcccgcgcgcgc
tcgcccaagcgactgttgttaattgtcctcggcagcctgaccggcacggccctgatcggc
ttgctggtcgtggtgttcgcgctggccatggcctacccgaatctgcccccgctcgacacc
ctgaccgactaccgcccgaagatgcccttgcggattttttcggccgataatgtgctgatc
ggcgagttcggcgaagaacggcgcaacctggtgcacatcaaggatattcccgaggtcatg
aagaaggcggtgctggcgatcgaagacgaccgcttttaccagcacggcggggtcgactac
accggcatcctgcgcgcggccttgcacaacgccaccggcggcgccaagcagggcgcctcg
accatcacccagcaggtggcgcgcaatttcttcctgtcgagcgagcagacgctcaagcgc
aaggcgtatgaagtgctgctggcctggaagatcgagcaaaacctgaccaaggaccagatc
ctcgaggtctacatgaaccagatctacctgggccagcgcgcctacggcttcgcttcggcg
gcccagatctacttcggcaagaacctgaaagacatcaccgtggccgaggccgcgatgctg
gccggcttgccgaaggcgccgtcggcctacaacccggtggtcaaccccaagcgcgcgcgc
acgcgccagcaatacatcctgcagcgcatgcacatgctgggctacatcaccacgccccag
ttcgagaccgccaaggccgaaacgctgcgcatcaagaccgacagcagcgaattcggcgtg
cacgccgaatacgtggccgaaatggcgcgccagctggtgtacgagcagttcaaggaagaa
acctatacgcgcggcctgaacgtgtttaccaccatcaccaaggccgaccaggatgcggcc
tacctggccctgcgccgcggcgtgatggagtacgagcggcgccacccttaccgcggtccg
gaatcgtatatcgagatcccgcaggcgaaggaagaagccgatgaagcgatcgaaaacgca
ctggccgagcaccccgacagcgacgacatcatcgccgccatggtgttgcaggcgtcgccc
accggcatcaccgccgtgacggcctcgggcgaggaagtcaagatcagcggcaccggcctg
gcattcgcccagaactggctctcgagcaaggccccggccaaccggcgcgtcaagcgcggc
gcggtgatccgcatcagccaggatggcgggacggcctggtcggtcacgcagatgccggaa
gtgcagtcggccttcgtggcggccgacgccaccgatggcgcgatccgcgcgctggtgggc
ggcttcgactacaaccgcaacaagttcaaccacgtcacgcaagcgtggcgccagcccggt
tcctcgttcaagccgttcatctattcggcctcgctggagcgcggcctgtcgccggcgacc
atcatcaacgacgccccgatctcgttcgacgccggccagaccggcggccaggcgtgggag
ccgaagaattacgacaacaagtacgaagggccgatgaccatgcggcgcgggctgaccaag
tcgaagaacatgatttcgatccgcatcctcaacaagatcggggccaagtacggccaggaa
tacacgacccgcttcggcttcgagtccgagaagaacccgccctacctgaccctggcgctt
ggtgcgggctcgaccacgccgctgcagctggccggcgcctacgccgtgttcgccaacggc
ggtttccgggtcagcccctacctgatctcgaaggtcaccgacagcagcggcaagatcctg
tcgcaagcgacgcccgacaagtcgggcgacgaagcgaaccgggtgatcgatgcgcgcaat
gccttcctggtcgacagcatgctcaaggatgtggtgcgcttcggcacggccaccaaggcc
ctgtcgctcaagcgcaccgacatttccggcaagaccggcaccaccaacgattcgatcgat
gcctggttcgccggctacaccccgaaactggtggggatcgcgtggatcggctacgaccag
ccgaaaaacctcggcaacaaggaaaccggcggcgggctggccctgccgatctggatcggc
tacatgcaaaaggcgctcaagggcgtgccgaacgaggagcgggcggtgcccgaggggctg
gtgatggcgggcgacgactattactatgtcgaaaatccgcccggcacgggagtgcagagc
ctcgacatcggcgcgcgcggcacgccggccgaggaaaaggtcaaggacgcggtcaagaac
gaactgttctga

DBGET integrated database retrieval system