KEGG   Massilia violaceinigra: CR152_04775Help
Entry
CR152_04775       CDS       T05157                                 

Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mass  Massilia violaceinigra
Pathway
mass00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mass00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CR152_04775
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mass02000]
    CR152_04775
Enzymes [BR:mass01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CR152_04775
Transporters [BR:mass02000]
 Other Transporters
  Pores ion channels [TC:1]
   CR152_04775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_C_2 GST_N GST_N_2 GST_N_3 GST_C_6
Motif
Other DBs
NCBI-ProteinID: ATQ73907
UniProt: A0A2D2DG10
LinkDB All DBs
Position
1038025..1038639
Genome map
AA seq 204 aa AA seqDB search
MKLYYSPGACSLAPHILLCEAKLPHTLIKVDTSTHRTQDGIDFYTINPKGHVPVLELDDG
QRLSEGPTIAQFIADHARRDDLMPVAGSMARYRVMEWQNYITSELHKSFSPLFNPALDAA
AKAVFAAILSKKFGWVSGQLRGRPYLTGDSFTAADAYLFTVAGWANYVKLDLSDFEHVQA
FLKRVASRAAVQEAMKAEGLQSAK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctactattcgcccggcgcctgctcgctcgcgccacatatcctgctgtgtgaa
gcaaaactgccgcatacgctcatcaaggtcgacaccagcacgcaccgtactcaagacggg
atcgatttttacaccatcaatccgaaaggccatgtgccggttctcgaactcgatgatggc
cagcgactgtccgagggaccgaccattgcgcaattcattgcagaccatgctcgccgcgac
gatttgatgcccgtcgccggatcgatggcgcgctatcgggtgatggagtggcagaactac
atcacgtccgagctgcacaagtcgttcagtccgctgttcaatccggcactggatgcagcg
gcgaaggcagtcttcgccgcaatcctgagcaagaaattcggctgggtatcgggccaattg
cgcggcaggccttacctgaccggtgacagttttaccgccgccgacgcctacctcttcacg
gtcgcgggctgggccaactatgtcaagctcgatttgtcggacttcgagcatgtgcaggca
ttcctcaaacgcgttgcatcgcgcgcggctgtgcaggaagcgatgaaggcagaaggtttg
cagagtgcgaaatga

DBGET integrated database retrieval system