KEGG   Massilia violaceinigra: CR152_06325Help
Entry
CR152_06325       CDS       T05157                                 

Gene name
cobT
Definition
(GenBank) nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase
  KO
K00768  nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase [EC:2.4.2.21]
Organism
mass  Massilia violaceinigra
Pathway
mass00860  Porphyrin and chlorophyll metabolism
mass01100  Metabolic pathways
Module
mass_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:mass00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CR152_06325 (cobT)
Enzymes [BR:mass01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.21  nicotinate-nucleotide---dimethylbenzimidazole phosphoribosyltransferase
     CR152_06325 (cobT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DBI_PRT
Motif
Other DBs
NCBI-ProteinID: ATQ74165
UniProt: A0A2D2DGT3
LinkDB All DBs
Position
complement(1400938..1401972)
Genome map
AA seq 344 aa AA seqDB search
MRLPDILSTHDPLLASELAQAIDNKTKPLGSLGALETLARQIGLIQQTTKVALHKPAILV
FAADHGVVAEGISAYPQSVTWQMVENFLSKGAAINVFARQNGCALQIIDAGVNHDFGKRV
ALMDCKVGRGTANFAQKPAMSWAECAAALAHGMRIVGNLEGNVIGFGEMGIGNTTAAAAL
MHKLTGVPVADCVGAGTGLSPEGVLHKQDVIEAAVALHGEMSEPLDILATFGGFEIAMIV
GAMLKAAERRMVLLIDGFIVSSALLVAARMQPAILDYCVFSHCSDEAGHARMLEHLKARP
LLNLGLRLGEGTGCALALPLLHAAVNFLGEMATFQSARVSGQSA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctccctgacatactttccacccacgacccattgctggccagcgaactggcccaa
gcgatcgacaacaagaccaagccgctgggcagcctgggcgcgctcgaaacgctggcccgg
cagattggcctgatccagcaaacgaccaaggtcgcgctgcacaagccggccatcctcgtg
ttcgcggccgatcacggcgtggtggcagaaggcatctcggcctatccgcaaagcgtcacc
tggcagatggtcgagaacttcctgtccaagggcgcggccatcaatgtgttcgcgcgccag
aacggctgcgcgctgcagatcatcgacgccggcgtgaaccacgatttcggcaaacgcgtg
gccctgatggactgcaaggtcggacgcggcaccgccaactttgcccagaagccggccatg
agctgggccgaatgcgccgccgccctggcgcacggcatgcgcatcgtcggcaacctggaa
ggcaatgtgatcggcttcggcgaaatgggaatcgggaacaccaccgccgccgccgcgctg
atgcacaagctgaccggcgtgccggtggccgattgcgtcggcgccggcacgggtttgtcg
cccgagggcgtgctgcacaagcaagacgtgatcgaggcggcggtcgccctgcatggcgag
atgagcgagccgctcgacatcctggccaccttcggcggcttcgagatcgccatgatcgtt
ggggccatgctcaaggcggccgagcggcgcatggtgctgctgatcgacggcttcatcgtc
agcagcgcgctgctggtggcggcgcgcatgcagccggccatcctcgactactgcgtattt
tcgcactgctcggacgaagcgggccacgcgcgcatgctcgaacacctcaaggccaggccg
ctgctcaacctcggtctgcgcctgggcgaaggcaccggttgcgccctggcgctgccgctg
ctgcacgcggccgtcaacttcctcggcgagatggccaccttccagtcggcgcgcgtcagc
ggccagtcggcgtaa

DBGET integrated database retrieval system