KEGG   Massilia violaceinigra: CR152_08040Help
Entry
CR152_08040       CDS       T05157                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mass  Massilia violaceinigra
Pathway
mass00473  D-Alanine metabolism
mass00550  Peptidoglycan biosynthesis
mass01100  Metabolic pathways
mass01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mass00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CR152_08040
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CR152_08040
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CR152_08040
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mass01011]
    CR152_08040
Enzymes [BR:mass01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CR152_08040
Peptidoglycan biosynthesis and degradation proteins [BR:mass01011]
 Precursor biosynthesis
  Amino acid ligase
   CR152_08040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp ATP-grasp_4 RimK CPSase_L_D2 GARS_A ATPgrasp_ST TTL
Motif
Other DBs
NCBI-ProteinID: ATQ74468
UniProt: A0A2D2DHL2
LinkDB All DBs
Position
1791121..1792089
Genome map
AA seq 322 aa AA seqDB search
MSVFNSGDAAALGKVGVLFGGRSAERDVSIMSGTGVLAALRSKGIDAHPFDTGLRSITEL
AAEEFDRVFIALHGRYGEDGTLQGALEQLGIPYTGSGVMACAIAMDKIYTKMIWLMRGLP
TPRYATLAADTDLAQVVEQLGLPLIVKPPHEGSSVGITKVRAAADFKAAYEVAAGFDEVV
LAEEFVTGRELTVAVLGRGATARALPIVEIVAPDGNYDYQNKYFTDDTKYVCPAALDEAT
SAEVARLAVEAYRAVDCEGWGRVDVLLRASDNKPFLIEVNTSPGMTTHSLVPMGARALGI
SYEDLCVEIVRSARLKMAQGQG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtatttaattccggcgacgccgccgcactgggcaaagtcggcgtgctgttcggc
ggccgctcggccgaacgcgacgtgtcgatcatgtccggcaccggcgtgctcgcggcgctg
cgcagcaagggcatcgacgcccatccgttcgacaccggcctgcgcagcatcaccgagctg
gcggccgaggaattcgaccgcgtgttcatcgcgctgcacggccgctacggcgaagacggc
accctgcagggcgcgctcgagcagcttggcattccctacaccggcagcggcgtgatggcg
tgcgcgatcgccatggacaagatctacaccaagatgatctggctgatgcgcggcctgccg
acgccgcgctacgccacgctggccgccgataccgacctggcgcaggtggtcgagcagctt
ggcctgccgctgatcgtcaagccgccgcacgaaggttcgagcgtgggcatcaccaaggtg
cgcgccgccgccgacttcaaggcggcctatgaggtggcggccggcttcgatgaagtggtg
ctggccgaggaattcgtcaccgggcgcgaactgacggtcgcggtgcttgggcgcggcgcg
actgcgcgcgcgctgccgatcgtcgaaatcgtggctccggacggcaattacgattaccag
aacaagtacttcaccgacgacaccaagtacgtttgcccggccgcgctggacgaagcgacc
agcgcggaagtggcgcgcctggcggtggaagcctaccgcgccgtcgattgcgaaggctgg
ggcagggtcgacgtgctgctgcgcgccagcgacaacaagccgttcctgatcgaggtcaat
acctcgccggggatgaccactcactcgctcgtgcccatgggcgcgcgcgcgctgggcatc
agttatgaagacctgtgcgtcgagattgtgcgttcggcacgcttgaaaatggcccagggc
cagggttaa

DBGET integrated database retrieval system