KEGG   Massilia violaceinigra: CR152_16085Help
Entry
CR152_16085       CDS       T05157                                 

Definition
(GenBank) galactose-1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
mass  Massilia violaceinigra
Pathway
mass00010  Glycolysis / Gluconeogenesis
mass00052  Galactose metabolism
mass01100  Metabolic pathways
mass01110  Biosynthesis of secondary metabolites
mass01120  Microbial metabolism in diverse environments
mass01130  Biosynthesis of antibiotics
Module
mass_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:mass00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CR152_16085
   00052 Galactose metabolism
    CR152_16085
Enzymes [BR:mass01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     CR152_16085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ATQ75878
UniProt: A0A2D2DLM0
LinkDB All DBs
Position
3608681..3609742
Genome map
AA seq 353 aa AA seqDB search
MQASIKQTAFGHLPDGRAATLTTLTNPNGLVVKITDFGGIITEIHTPDRNGTLADITLGF
DTVAPYVKDSPYFGALIGRYGNRLRGGRFTLDGQVVQLPTNNGPNHLHGGELGFHRVLWR
AIPFQEGDSVGVTLIYRSPDGEQGYPGTLDVTVVYELTAADELVVAFDAVTDKATPVNLT
QHAYFNLAGGGDILGHVLRIDADATTPIDHTLIPTGELAPVAGTAFDFRTPHAIGERIGN
DDEQLRHAGGYDHNFVLNKPAPRATTLAARVHEPVSGRVLELFTEEPGVQFYSGNFLDGT
LSGKGRTYGFRSGFCLEPQHFPDSPNQSTFPNTILRPGEEYATVSRYKFSVEK
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagccagtatcaagcaaaccgcattcggccatctgcccgacggcagggccgccacg
ctgaccaccttgaccaacccgaacgggctggttgtcaagatcaccgatttcggcggcatc
atcaccgaaatccatacgcccgaccgcaacggcacccttgccgatatcacgctcggcttc
gacacggtcgcgccgtacgtgaaggactcgccgtacttcggcgcactgatcgggcgctac
ggcaatcgcctgcgcggtggccgcttcacgctcgacggccaggtggtgcaactgcccacc
aataacggccccaaccacttgcacggcggcgagctgggcttccaccgcgtgctgtggcgc
gccattcctttccaggaaggcgactcggtcggcgtcaccctgatctaccgcagccctgac
ggcgagcagggctatcccggcacgctcgacgtgaccgtggtgtacgaactgaccgccgcc
gacgagctggtggtcgccttcgatgcggtgaccgacaaggccacgccggtcaacctgacc
cagcacgcgtacttcaacctggccggcggcggcgacatcctcggccacgtgctgcgtatc
gatgccgatgccaccacgccgatcgaccataccctgattcccacgggcgaactggcgccg
gtggccggcaccgccttcgatttccgcacgccgcacgccatcggcgagcgcatcggcaac
gatgacgagcaattgcgccacgccggcggctacgaccataacttcgtgctcaacaaacct
gcacccagggcgacgaccctggccgcgcgcgtgcacgagccggtgtcgggccgggtgctc
gaactgttcacggaagaaccgggcgtgcagttttacagcggtaatttcctcgacgggaca
ctgagcggcaagggccggacctacggctttcgcagcggcttctgcctggaaccgcagcac
tttcccgattcgcccaaccagagcacgtttccgaacactatcttgcgccctggtgaggaa
tatgcgactgtatcgcggtacaaattttcggtggagaagtga

DBGET integrated database retrieval system