KEGG   Massilia violaceinigra: CR152_28965Help
Entry
CR152_28965       CDS       T05157                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mass  Massilia violaceinigra
Pathway
mass00620  Pyruvate metabolism
mass00680  Methane metabolism
mass01100  Metabolic pathways
mass01120  Microbial metabolism in diverse environments
mass01200  Carbon metabolism
Module
mass_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mass00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CR152_28965
  09102 Energy metabolism
   00680 Methane metabolism
    CR152_28965
Enzymes [BR:mass01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CR152_28965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ATQ78092
UniProt: A0A2D2DSY8
LinkDB All DBs
Position
6737308..6740127
Genome map
AA seq 939 aa AA seqDB search
MVNLSAAQETPPVLDKDAPLKEDIRLLGRLLGDVLRDQEGEAVFDVVETIRQTAVRFRRE
DDAQAGEDLTALLHKLTREQTISVVRAFSYFSHLANIAEDQHHIRRRRAHLLAGSAPQQG
SVSFALSKLKAAGVGSDTVRTFFGDALIAPVLTAHPTEVQRKSILDAEHDIARLLAERDL
PLTPRERVANMQLLHARIATLWQTRMLRYSKLTVADEIDNALSYYRITFLRELPGLYDDI
EEEIAAHYPDDADGAAPGNDNSYVQMGSWIGGDRDGNPNVNAGTMQHALVRQATTILDFY
LDEVHALGAELSISTLMVGASPALQALADASPDQSPHRSDEPYRRALIGIYARLAATARS
LGATNILRKEVGHAAPYLDATEFCTDLQVLADSLRAHHGQLLVKPRLATVQRAAAIFGFH
LASLDMRQTSDVHERVLAELFAGAGVEADYTKLTEEQKVQLLLAELAQPRLLYSPYAELS
EETASELAILRAAKDIRQRYGKRAIRNYIISHTETVSDLLEVLLLQKETGLLRPRDKQLD
AMVIPLFETIPDLQRAAGIMNEWMALPLVKELIAHQGQLQEVMLGYSDSNKDGGFLTSNW
ELYKAEIHLVKVFADAGVKLRLFHGRGGTVGRGGGPSYEAILAQPPGTVNGQIRLTEQGE
IIASKFSNAEIGRRNLELLVAATLEASLMPHAAEGAKAKQLAGFEAIMADLSERAYKAYR
NLVYETPGFTDYFFSATPIAEIAELNLGSRPASRKSTKRIEDLRAIPWGFSWGQCRLLLP
GWYGFGSAITQWVEEGERDAKIATLQAMFKEWPFFATLLSNMDMVLAKTDLAIASRYAGL
VADVELRERIFKRISAEHGTTLRCLEMITGAHERLAGNPLLARSIQNRFAYLDPLNHLQV
ELIHRHRALSGEPDKVDERVHRGIHLSINGVAAGLRNTG
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atggtaaatttatctgctgcacaagaaacccctccagtcctcgacaaggacgctccgctg
aaagaagatatccgcctgctcggccgcctgctcggtgacgtgctgcgcgaccaggaaggc
gaagccgtcttcgatgtcgtcgagaccatccgccagaccgcggtgcgtttccggcgcgag
gacgacgcccaggccggcgaggacctgaccgccctgctgcacaagctcacgcgcgagcaa
accatttcggtggtgcgcgcattttcgtatttttcgcacctggccaacatcgccgaggac
cagcaccacatccgccgccgccgcgcccacctgctggccggctcggcgccgcaacagggc
agcgtgagcttcgcgctgtccaagctgaaagccgcgggcgtgggcagcgacaccgtgcgc
acctttttcggcgacgccctgatcgcgccggtgttgacagcccacccgaccgaagtgcag
cgcaagagcatcctcgacgccgagcatgacatcgcgcgcctgctggccgaacgcgacctg
ccgctcaccccgcgcgaacgcgtggccaacatgcagttgctgcacgcgcgcatcgcgacc
ttgtggcaaacgcgcatgctgcgctactccaagctgaccgtggccgacgaaatcgacaac
gccctgtcctactaccgcatcaccttcctgcgcgaattacccggcctgtacgacgacatc
gaagaagaaatcgccgcgcattatcctgatgatgcggacggtgcggcgcccggcaacgac
aactcctacgtgcagatgggcagctggatcggcggcgaccgcgatggcaacccgaacgtc
aacgccggcaccatgcagcacgcgctggtgcgccaggccaccaccatcctcgacttctat
ctcgacgaagtgcacgcgctgggcgccgaactgtcgatttcgaccctgatggtaggcgcc
agcccggccctgcaagcgctggccgacgcctcgcccgaccagtcgccgcaccgcagcgac
gagccataccggcgcgccctgatcggcatctacgcgcgcctggccgccaccgcgcgttcg
ctgggcgcgaccaacatcctgcgcaaggaagtcggccacgccgcgccttacctggacgcc
accgaattctgcaccgacctgcaggtgctggccgactcgctgcgcgcccatcacgggcag
ttgctggtcaagccgcgcctggccacggtgcagcgcgccgccgccatcttcggcttccat
ctggcctcgctcgacatgcgccagacctccgacgtgcatgaacgcgtgctggccgaactg
ttcgccggcgccggcgtcgaagccgattacaccaagctcaccgaagaacaaaaggtgcag
ctgctgctggccgaactggcgcaaccgcgcctgctgtattcgccgtacgccgaattgagc
gaggaaaccgcatccgaactggcgatcctgcgcgcggccaaggatatccgccagcgctac
ggcaagcgcgcgatccgcaactacatcatttcgcacaccgagaccgtgtccgacctgctc
gaagtgctgctgctgcaaaaggaaaccggcctcctgcgcccgcgcgacaagcagctcgac
gccatggtcatcccgctctttgaaaccattcccgacctgcagcgcgcggccggcatcatg
aacgagtggatggcgctgccgctggtgaaagaactgatcgcgcatcagggccagctgcag
gaagtcatgctcggctactcggactcgaacaaggatggcggcttcctgacgtcgaactgg
gagctgtacaaggccgaaatccacctggtcaaggtgttcgccgacgccggcgtcaagctg
cgcctgttccatggccgcggcggcacggttggccgcggtggtggaccgagctacgaagcg
atcctggcgcagccgccgggcaccgtcaatggccagatccgcctgaccgaacagggcgaa
atcatcgcctccaagttctcgaacgccgaaatcggccgccgcaacctggagctgctggtc
gccgccacgctcgaagcgagcctgatgccgcacgccgccgaaggcgccaaggccaagcag
ctggccggcttcgaggccatcatggccgacctgtccgagcgcgcctacaaggcttaccgc
aacctggtctacgaaacgccgggcttcaccgattactttttctcggccacgccgatcgcc
gaaatcgccgaactcaatctcggttcgcgtccggcctcgcgcaagtcgaccaagcgcatc
gaagacctgcgcgccattccgtgggggttctcatggggccagtgccgcctgctgctgccg
ggctggtacggcttcggttcggccatcacgcaatgggtcgaggaaggcgagcgcgatgca
aagatcgcgaccctgcaagccatgttcaaggagtggccgttttttgccacgctgctgtcg
aacatggacatggtgctggccaagaccgacctggcgatcgcttcgcgctacgcgggcctg
gtggccgacgtggaactgcgcgagcgcatcttcaagcgcatttcggccgaacacggcacc
accctgcgctgcctggagatgatcaccggcgcgcacgaacgcctggccggcaatccgctg
ctggcgcgctcgatccagaaccgcttcgcctacctcgatccgctgaatcacttgcaggtc
gagctgatccaccgccatcgcgcgctgtcgggcgagccggacaaggtcgacgagcgggtc
catcgcggcatccacctgtcgatcaacggcgtcgccgccggcctgcgcaatacgggttaa

DBGET integrated database retrieval system