KEGG   Massilia sp. WG5: AM586_04640Help
Entry
AM586_04640       CDS       T04122                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
masw  Massilia sp. WG5
Pathway
masw00010  Glycolysis / Gluconeogenesis
masw00620  Pyruvate metabolism
masw01100  Metabolic pathways
masw01110  Biosynthesis of secondary metabolites
masw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:masw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AM586_04640
   00620 Pyruvate metabolism
    AM586_04640
Enzymes [BR:masw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     AM586_04640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ALK95669
LinkDB All DBs
Position
4218456..4219976
Genome map
AA seq 506 aa AA seqDB search
MNLADISKLGVANPFRQRYDNYIGGQFVAPVKGEYFANVTPITGQPFCEVARSTAEDIDA
ALDAAHAAREAWGKTSPTERANILNKIADRMEQNLKMLATAETIDNGKPIRETMAADLPL
AIDHFRYFAGCIRTQEGAISTIDHETYAYHFHEPLGVVGQIIPWNFPILMAVWKLAPALA
AGNCVVLKPAEQTPASIMVLIELIGDLLPAGVINIVNGYGLEAGKPLASSKRIAKIAFTG
ETGTGRLIMQYAAQNLIPVTLELGGKSPNIFFADVMDADDEFFDKCLEGFAMFALNQGEV
CTCPSRVLVQESIYEKFMERALARVARIKAGNPLDESTMIGAQASQEQLEKILSYLDIGR
QEGAEVLAGGERATHEGDLSGGYYVHPTVFKGDNRMRIFQEEIFGPVVSVTTFKDEADAL
RIANDTLYGLGAGLWTRDGSRAFRVGRAIQAGRVWTNCYHLYPAHAAFGGYKQSGIGREN
HKMMLDHYQQTKNLLVSYSPKALGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaacctggcagacatcagcaaactcggcgtcgcaaaccccttccgtcagcgctacgac
aactacatcggcggccagttcgttgcgccggtcaagggcgagtatttcgccaacgtaacc
ccgatcaccggccagcccttctgcgaagtggcgcgctcgaccgcggaagacatcgacgcc
gcgctcgacgctgcccatgccgccagggaagcctggggcaagacctcgcccaccgagcgt
gccaacatcctgaacaagatcgcggatcgcatggagcagaacctcaagatgctcgcgacc
gccgaaaccatcgacaacggcaagccgatccgcgagacgatggcggccgacctgccgctg
gcgatcgaccatttccgctacttcgccggctgcatccgcacccaggaaggcgcgatctcg
accatcgaccacgagacctacgcctaccacttccatgagccgctgggcgtggtcggccag
atcatcccctggaatttcccgatcctgatggcggtgtggaagctggcgcccgcgctcgcg
gccggcaactgcgtcgtgctcaagccggccgaacagaccccggcctcgatcatggtgctg
atcgagctgatcggcgacctgctgccggccggcgtgatcaacatcgtcaacggctacggc
ctggaagccggcaagccgctcgcttccagcaagcgcatcgccaagatcgccttcaccggc
gagaccggcaccggccgcctgatcatgcagtacgcggcgcagaacctgatcccggtgacg
ctggaactgggcggcaagtcgccgaatatcttcttcgcggacgtgatggatgcggacgac
gagttcttcgacaagtgcctggaaggcttcgccatgttcgcgctgaaccagggcgaggtc
tgcacctgcccgtcgcgggtgctggtgcaggaatcgatctacgagaagttcatggagcgt
gcgctggcgcgggtcgcccggatcaaggccggcaatccgctcgacgagagcaccatgatc
ggcgcccaggcctcgcaggagcagctcgagaagatcctgtcctacctcgacatcggccgc
caggaaggcgccgaggtgctggccggcggcgagcgcgccacccacgagggcgacctgtcc
ggcggctactacgtgcatccgaccgtgttcaagggcgataaccggatgcgcatcttccag
gaagagatcttcggcccggtggtgtcggtcaccaccttcaaggacgaagccgatgccctg
cgcatcgccaacgacaccctgtacggcctgggcgccggcctgtggacccgcgacggcagc
cgcgccttccgcgtcggccgcgcgatccaggcgggccgggtctggaccaactgctaccac
ctgtacccggcgcatgcggccttcggcggctacaagcagtcgggcatcgggcgcgagaac
cacaagatgatgctcgatcactaccagcagaccaagaacctgctggtgagctacagcccg
aaggcgctcggcttcttctga

DBGET integrated database retrieval system