KEGG   Massilia sp. WG5: AM586_04800Help
Entry
AM586_04800       CDS       T04122                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
masw  Massilia sp. WG5
Pathway
masw00970  Aminoacyl-tRNA biosynthesis
masw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:masw00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AM586_04800
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:masw03029]
    AM586_04800
Enzymes [BR:masw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AM586_04800
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AM586_04800
Mitochondrial biogenesis [BR:masw03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AM586_04800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ALK95694
LinkDB All DBs
Position
complement(4250849..4252324)
Genome map
AA seq 491 aa AA seqDB search
MHNKTIKELSTLLHSKQISATELTRHYLDRIAASQHNAFLHVDAELSLAQAQAADARFAE
GSAGPLTGIPIAHKDIFVTKGWRSTAASKMLGNYVSPFDATVVTKFLDAGMVTLGKLNCD
EFAMGSANENSSFGAVQNPWDTLAVPGGSSGGSAAAIAARLAPAATGTDTGGSIRQPAAF
CGITGIKPTYGRVSRFGMIAFASSLDQGGPMARTAEDCALLLNEMVGFDERDSTSLTAEQ
GNAREDFTRQLNQPLNGLRIGVPKEYFGEGLAADVEQAVRAALDQFVKLGATLVEISLPK
TSLSIPVYYIIAPAEASSNLSRFDGVRYGYRTQEYKDLQDMYKKTRAEGFGKEVQRRIMV
GTYVLCHGYYDAYYVQAQKIRRLIADDFQAAFKDKCDVIMGPVAPTVAWDLGAKSDDPVA
NYLADIFTLSTSLAGLPGMSIPVGFGQGEKNAKRPVGLQIIGNYFSEARLLNIAHQYQQA
TDWHTRTPDGV
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgcacaacaaaaccatcaaagaactgtcgacgctcctgcattcgaaacagatctcggcg
accgagctgacccgccactacctggaccgcatcgccgcgagccagcacaacgccttcctg
cacgtcgacgccgagctgtcgctggcccaggcccaggccgccgacgcgcgcttcgccgaa
ggttcggccggcccgctgaccggcatcccgatcgcgcacaaggacatcttcgtcaccaaa
ggctggcgctcgaccgccgcttcgaagatgctgggtaactacgtcagcccgttcgatgcg
accgtggtcacgaagtttctggatgccggcatggtcacgctgggcaagctgaactgcgac
gagttcgcgatgggctcggccaacgagaactcgagcttcggcgcggtccagaatccctgg
gataccctggcggtgccgggcggctcctcgggcggctcggccgccgcgatcgccgcgcgc
ctggcgccggccgcgaccggcaccgacaccggcggctcgatccgccagccggccgccttc
tgcggcatcaccggcatcaagccgacctacggccgcgtgtcgcgcttcggcatgatcgcc
ttcgcctcctcgctcgaccagggcggcccgatggcgcgcaccgccgaggactgcgccctg
ctgttgaacgagatggtgggcttcgacgagcgcgactcgaccagcctcaccgccgaacag
ggcaatgcgcgcgaggactttacccgccagttgaaccagcccttgaatggactgcggatc
ggcgtaccgaaagagtacttcggcgaaggcctggccgcggacgtcgagcaggccgtgcgc
gccgcgctggaccagttcgtcaagctgggcgcgaccctggtcgagatctcgctgccgaag
acctcgctgtcgatcccggtctactacatcattgcccccgcggaggcatcgagcaacctg
tcgcgcttcgacggcgtccgctacggctaccgcacgcaggagtacaaggacctgcaggac
atgtacaagaaaacgcgtgcggaaggcttcggcaaggaagtccagcgccgcatcatggtc
ggcacctacgtgctgtgccacggctactacgacgcctactacgtgcaggcgcagaagatc
cgccgcctgatcgccgacgacttccaggccgcgttcaaggacaagtgcgacgtcatcatg
ggcccggtggccccgaccgtggcctgggacctgggcgccaaatcggacgacccggtcgcc
aattacctggccgacatcttcaccctgtcgaccagcctggcgggcctgcccggcatgtcg
atcccggtcggtttcggccagggcgagaaaaacgccaagcgtccggtcggcctgcaaatc
atcggtaactatttcagcgaagccaggctgctgaacatcgcgcaccagtaccagcaagcc
accgactggcacacccgcacacccgacggcgtctaa

DBGET integrated database retrieval system