KEGG   Massilia sp. WG5: AM586_10050Help
Entry
AM586_10050       CDS       T04122                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
masw  Massilia sp. WG5
Pathway
masw00620  Pyruvate metabolism
masw00680  Methane metabolism
masw01100  Metabolic pathways
masw01120  Microbial metabolism in diverse environments
masw01200  Carbon metabolism
Module
masw_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:masw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AM586_10050
  09102 Energy metabolism
   00680 Methane metabolism
    AM586_10050
Enzymes [BR:masw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AM586_10050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ALK96569
LinkDB All DBs
Position
complement(5453180..5456014)
Genome map
AA seq 944 aa AA seqDB search
MNKAANPDHQADPQVADPAPAPGDKDAPLKEDIRLLGRLLGDVLRNQEGEAVFDVVETIR
QTAVRFRREDDPQAGEELTGLLKKLSREETNSVVRAFSYFSHLANIAEDQHHVRRRRAHQ
LAGSTPQPSSVAYALTRLQEAGVERGQIERFLREALISPVLTAHPTEVQRKSILDAEHDI
ARLLAERDLPLTPKERAHNMMLLQARVATLWQTRMLRYEKLTVADEIENALSYYRTTFLR
ELPAVYDDIEEELQAKLDDAVYLQMGSWIGGDRDGNPNVNAGTMQRALVRHATTIFDYYL
DEVHALGAELSTSTLLVQASAALDALAAASPDTSPHRADEPYRRALIGIYARLAATAREL
GATNPLRKEVGHAEAYADAAEFQAELQVLVDSLNANHGAILVKPRLAGLLRAAGIFGFHL
ASLDMRQSSDVHERVLAELFAAASVEADYAKLDEAAKVKLLLAEIAQPRLLYSPYQDYSD
ETKSELQILRTAREIRKRYGKRAIRNYIISHTETVSDLLEVLLLQKETGLLRSTGKEQQC
DVMVIPLFETIPDLQRAGDIMGEWMAIPVVKALIERQGSLQEVMLGYSDSNKDGGFLTSN
WELYQAELKLVKVFGEAGVKLRLFHGRGGTVGRGGGPSYDAILAQPPGTVNGQIRLTEQG
EIISSKFSNPEIGRRNLELLVAATLEAGLMPHGVDPAQVARLAGYEKVMAELSERAYKAY
RNLVYETPGFTDYFFAATPIAEIAELNLGSRPASRKSTRRIEDLRAIPWGFSWGQCRLLL
PGWYGFGAAVSGWLKDGETGGDRDQRLVLLKEMFEQWPFFATLLSNMDMVLAKTDLPIAR
RYAELVPDAELRERIFKRIAAEYGETLRCLEQVTGKAERLAANPLLARSIQNRFAYLDPL
NHLQVELIERHRALSQDPEQIDVRVHRGIHLSINGVAAGLRNTG
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagctgcaaaccccgatcaccaagccgatccgcaagtcgcggacccggcgccc
gcgcccggcgacaaggacgcgccgctgaaagaagacatccgcctgctcggccgcctgctg
ggcgacgtgctgcgcaaccaggagggcgaggccgtgttcgacgtggtcgagaccatccgc
cagaccgcggtgcgtttccgtcgcgaggacgacccgcaggccggcgaagagctcacgggc
ctgctgaagaaactctcgcgcgaagagaccaactcggtggtccgcgcgttttcctatttc
tcgcacctggccaacatcgccgaagaccagcatcatgtgcgccgccgccgcgcccaccag
ctcgccggctcgacgccgcagccgtccagcgtggcctacgccctcacgcgcctgcaggaa
gccggtgtcgagcgcggacagatcgagcgttttctccgcgaagccctgatttcgccggtg
ctgaccgcccacccgaccgaggtccagcgcaagtccatcctggacgccgagcacgacatc
gcacgcctgctggccgagcgcgacctgccgctgacgccgaaggagcgcgcgcacaacatg
atgctgctgcaggcgcgcgtggcgacgctgtggcagacccgcatgctgcgctacgagaag
ctgaccgtggccgacgagatcgaaaacgccctgtcctactaccgcacgactttcctgcgc
gaactgccggccgtgtacgacgacatcgaggaagagctgcaggcaaagctggacgatgcc
gtctacctgcagatgggcagctggatcggcggcgaccgcgacggcaacccgaacgtcaac
gccggcaccatgcagcgcgccctggtgcgccacgccaccaccatcttcgactactacctc
gacgaggtgcacgcactgggcgccgaactgtcgacctcgaccctgctggtgcaggccagc
gccgcactcgacgcgctggcggcggcctcgcccgacacctcgccgcaccgcgccgacgag
ccctaccggcgcgccctgatcggcatctacgcgcgcctggccgcgaccgcgcgcgaactg
ggcgccaccaacccgctgcgcaaggaagtcggtcacgccgaagcctatgcggatgcggcc
gagttccaggccgagctgcaggtgctggtcgattccctgaacgccaaccacggcgcgatc
ctggtcaagccgcgcctggccggcctgctgcgcgccgccggcatcttcggcttccacctg
gcctcgctcgacatgcgccagagctcggacgtccacgagcgcgtgctggccgaactgttc
gccgccgcctcggtcgaagccgactacgcgaaactcgacgaggcggccaaggtcaaactg
ctgctggccgagatcgcccagccgcgcctgctgtactcgccctaccaggactattcggac
gagaccaaatcggagctgcagatcctgcgcacggcgcgcgagatccgcaagcgctacggc
aagcgcgcgatccgcaactacatcatctcgcacaccgagaccgtctccgacctgctggaa
gtcctgctgctgcagaaggaaaccggcctgctgcgctcgaccggcaaggaacagcagtgc
gacgtgatggtgatcccgctgttcgagaccatccccgacctgcagcgcgccggcgacatc
atgggcgagtggatggcgatcccggtcgtgaaggccctgatcgaacgccagggcagcctg
caggaagtcatgctgggctattcggactcgaacaaggacggcggcttcctgacctcgaac
tgggagctgtaccaggccgagctgaagctggtgaaggtgttcggcgaggccggcgtcaag
ctgcgcctgttccacggccgcggcggcacggtcggccgcggcggcggccccagctacgac
gcgatcctggcccagccgccgggcaccgtgaacggccagatccgcctgaccgaacagggc
gagatcatctcctcgaagttctcgaacccggagatcgggcgccgcaacctcgaactgctg
gtggcggccacgctcgaagcgggcctgatgccgcacggcgtcgatccggcccaggtcgcg
cgcctggccggctacgagaaggtgatggccgaactgtccgagcgcgcctataaagcctat
cgcaacctggtgtacgagaccccgggctttaccgactacttcttcgccgccacgccgatc
gccgagatcgccgagctgaacctcggctcgcgcccggcctcgcgcaagtcaacccgccgc
atcgaagacctgcgcgcgattccctggggcttctcctggggccagtgccgcctgctgctg
ccgggctggtacggcttcggcgcggcggtctcgggctggctgaaggatggggaaacgggc
ggcgaccgggatcaacgcctggtgctgctgaaggagatgttcgagcagtggcccttcttc
gccaccctgctgtcgaacatggacatggtgctggccaagaccgacctgccgatcgcgcgc
cgttacgccgaactggtgccggacgcggagctgcgcgaacgcatcttcaagcgcatcgcg
gccgagtacggcgaaaccctgcgctgcctggagcaggtcaccggcaaggccgagcgcctg
gcggcgaacccgctgctggcgcgttcgatccagaaccgcttcgcctacctggatccgctg
aatcacctccaggtcgagctgatcgaacggcaccgggcgctgtcgcaggatccggagcag
atcgacgtgcgcgtgcatcgggggattcacctgtcgatcaacggcgtggcggcgggcttg
cgcaacaccggctga

DBGET integrated database retrieval system