KEGG   Massilia sp. WG5: AM586_19455Help
Entry
AM586_19455       CDS       T04122                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
masw  Massilia sp. WG5
Brite
Enzymes [BR:masw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     AM586_19455
Peptidases [BR:masw01002]
 Metallo Peptidases
  Family M2
   AM586_19455
Exosome [BR:masw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AM586_19455
CD molecules [BR:masw04090]
 Proteins
  AM586_19455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: ALK99721
LinkDB All DBs
Position
complement(1540563..1542425)
Genome map
AA seq 620 aa AA seqDB search
MHPRYRRSVIATLVAGAVMALPAAAATRATPTKTQGKPTVAEAERFIKDAEDRLEQLGLD
AQRAEWVAENFITLDTQTMTAQANEGYLTLSGETALKARRYKDLKLPEASARKLMLLQQT
LMLPEAADRATYARLAAHMTGAYGSAKYCPEAAAGAAAKPACMPLGELEKVLATSRDPNR
LKEAWLGWHAQSPAYKDDYAKYVEVSNKGARAMGYADTGALWRSGYDMSPEAFSSEMERL
WQQVKPLYDSLHTYTRFKLRQAYGASVVPATGPIPAHLLGNMWAQSWDNLYPLLKPAAKE
GGEDLTALLEERKTDAVAMTRYAEGFYTSLGMRALPPTFWERSLLTKPRDREVVCHASAW
DLDGKDDVRVKMCITPTAEDFRVIHHELGHLYYDLAYSGQSPMFKNGANDGFHEAIGDTV
ALSITPAYLKKIGLMKTEPDPSQDIGPLLYTALQKVAFLPFGYMVDKWRWQVYSGQVKPA
DYDKAWWALKEQYQGVSRPAPVLDKGFDAGAKFHVASDTPYARYFLAHVLQFQFHRALCR
EAGYTGPLNRCSVYGNKEAGAKFQQMLAMGKSKPWPEALKAITGEDKMDATAMLDYFAPL
KQWLDEQNRELAKTDASVKP
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgcatccacgctatcgccgcagtgtgatcgcaacgctggtggccggcgccgtcatggcg
ctgccggccgccgccgccacccgggcgacgcccacgaaaacccagggcaagccgaccgtc
gccgaggcggagcgcttcatcaaggacgccgaggacaggctcgaacagctcggcctggac
gcccagcgcgccgaatgggtggccgagaacttcatcacgctcgacacccagaccatgacg
gcccaggccaacgaaggctacctgaccctgagcggcgagaccgccctgaaggcgcgccgc
tacaaggacctgaagctgcccgaggcgagcgcccgcaagctgatgctgctgcagcagacc
ctgatgctgccggaggctgccgaccgcgccacctacgcccgcttggcggcgcacatgacc
ggcgcctacggctcggccaagtactgcccggaggccgccgccggcgccgccgccaagccg
gcctgcatgccgctcggcgaactcgaaaaagtgctggccaccagccgcgacccgaatcgc
ctgaaggaagcctggctgggctggcacgcccagtcgccggcctacaaggacgactacgcg
aaatacgtcgaggtctcgaacaagggcgcgcgcgcgatgggttatgccgacaccggcgcg
ctgtggcgctcgggctacgacatgagcccggaagccttttcaagcgagatggagcgcctg
tggcagcaggtcaagccgctgtacgattcgctgcacacctacacccgcttcaagctgcgc
caggcctacggcgcctccgtggtgccggcgaccggcccgatcccggcccacctgctgggg
aatatgtgggcgcagagctgggacaacctgtacccgctgctcaagcccgcggcgaaagag
ggcggcgaagacctgaccgcgctgctggaagagcgcaagaccgacgccgtggcgatgacc
cgctatgccgaaggcttctacacctcgctcggcatgcgtgcgctgcctcccaccttctgg
gagcgctcgctgctgaccaagccgcgcgaccgtgaagtggtatgccacgcctcggcttgg
gacctggacggcaaggacgacgttcgggtgaagatgtgcatcaccccgaccgccgaggac
ttccgcgtcatccaccatgagctgggccacctgtactacgacctggcctacagcgggcag
tcgccgatgttcaagaacggcgccaacgacggcttccacgaagccatcggcgacaccgtg
gcgctgtcgattaccccggcctacctgaagaaaatcggcctgatgaagaccgagccggat
ccgtcccaggacatcggcccgctgctctacaccgcgctgcagaaggttgccttcctgccc
ttcggctacatggtcgacaaatggcgctggcaggtgtattccggccaggtcaagccggcc
gactacgacaaggcctggtgggcgttgaaggaacagtaccagggcgtctcgcgtccggcc
ccggtgctcgacaaggggttcgacgccggcgccaagttccacgtcgccagcgataccccg
tacgcgcgctacttcctggcccacgtcctgcagttccagttccaccgcgcgctgtgccgc
gaagccggctacaccggcccgctgaaccgctgctcggtgtatggcaacaaggaggccggc
gccaagttccagcagatgctcgcgatgggcaagtcgaagccgtggccggaagcgctgaag
gccatcaccggcgaagacaagatggatgcgacggcaatgctggattacttcgcgcccttg
aagcagtggctggacgagcagaaccgcgagctggcgaagacggatgcgtcggtgaagccc
tga

DBGET integrated database retrieval system