KEGG   Massilia sp. WG5: AM586_21265Help
Entry
AM586_21265       CDS       T04122                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
masw  Massilia sp. WG5
Brite
KEGG Orthology (KO) [BR:masw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AM586_21265
Enzymes [BR:masw01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AM586_21265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 HI0933_like DAO FAD_binding_3 Glutaredoxin AlaDh_PNT_C Thi4 K_oxygenase FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ALK98335
LinkDB All DBs
Position
complement(1925191..1926774)
Genome map
AA seq 527 aa AA seqDB search
MSALDNDMKTQLGAYLQRVQHSFEMVASLDDSDTSKQMLDLLQTIQGLRADKITLRTDGN
DARRPSFSLQRLGADTSLRFAGLPLGHEFTSLVLALLWTGGHPPKVEQDVIDTIKSLDGD
YEFDVYMSLSCHNCPDVVQALSLMAILNPRVKTTVIEGGAFQKEVEERQVMAVPMVFLNG
EMFGSGRMMLEEIVAKLDKGAGERDAAKLNAKEPYDVLIVGGGPAGSAAAVYAARKGIRT
GIATGRMGGQVNDTMSIENYISVLETDGPKFSAALEAQVRHYGVDIMTQQEAAQLIAPSK
PGELVEVKFANGGSLKSSTVILSTGARWRNVNVPGEQEYKNAGVNYCPHCDGPLYKGKRV
AVIGGGNSGVEAAIDLAGIVEHVTLIEFANQLKADAVLVNKLHSLPNVSVHVNAQTTEIT
GDGKKVNGISFKDRLSGEDRHVELAGVFVQIGLVPNTEWLKGSVELSRFGEIVVDAHGRT
NVPGVFAGGDATTTPFKQIVIAAGDGAKCALSAFDYLIRMPVAVEAA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctctcgacaatgatatgaagacccagctgggtgcctacctgcaacgcgtccag
cattccttcgagatggtggcctcgctcgacgacagcgacacctcgaagcagatgctcgac
ctgctgcaaaccatccagggcctgcgcgccgacaagatcacgctgcgcacagacggcaac
gatgcccgccggccgtccttcagcctgcagcgcctgggcgccgacaccagcctgcgcttc
gccggcctgccgctgggccatgaattcacctcgctggtgctggccctgctgtggaccggc
ggccatccgccgaaggtcgagcaggacgtcatcgacaccatcaagagcctggacggcgac
tacgagttcgacgtctacatgtcgctgagctgccataactgcccggacgtggtgcaggcg
ctgtcgctgatggcgatcctgaacccgcgtgtcaagaccaccgtgatcgaaggcggcgcc
ttccagaaggaagtcgaagaacggcaggtgatggcggtgccgatggtgttcctgaacggc
gagatgttcggttccggccgcatgatgctcgaagaaatcgtcgccaagctggacaagggc
gccggcgagcgcgacgccgccaagctgaatgcgaaggaaccgtacgatgtgctgatcgtc
ggcggcggcccggccggctcggcagcggccgtgtatgcggcccgtaaaggcatccgcacc
ggcatcgccaccggccgcatgggcggccaagtgaacgacaccatgtcgatcgagaattac
atctcggtgctggaaaccgacggcccgaaattctccgccgcgctggaagcccaggtgcgc
cattacggcgtcgacatcatgacccagcaggaagccgcgcagctgatcgcgccatcaaag
ccgggtgagctggtcgaggtgaaattcgccaacggcggttcgctgaagtcgagcaccgtg
atcctgtcgaccggcgcgcgctggaggaacgtcaacgtgcccggcgagcaggaatacaag
aacgccggcgtgaactactgcccgcactgcgacggtccgctgtacaagggcaagcgcgtg
gccgtgatcggcggcggcaactcgggcgtggaagcggcgatcgacctggccggtatcgtc
gagcacgtgaccctgatcgagttcgcgaaccagctgaaggcggacgcggtgctggtcaac
aagctgcacagcctgccgaacgtgagcgtccacgtgaacgcccagaccacggaaatcacc
ggcgacggcaagaaggtcaacggcatcagcttcaaggaccgcctgtcgggcgaagaccgc
cacgtcgagctggcaggcgtgttcgtgcagatcggcctggtgccgaacaccgaatggctg
aagggcagtgtggagctgtcgcgcttcggcgagatcgtggtcgacgcccacggccgcacg
aatgtgccgggcgtgttcgccggcggcgacgccaccaccacgccgttcaagcagatcgtg
atcgcggcgggcgacggcgccaagtgcgcactgtcggccttcgattacctgatccgcatg
ccggtggcggtcgaagcggcctga

DBGET integrated database retrieval system