KEGG   Massilia sp. WG5: AM586_24155Help
Entry
AM586_24155       CDS       T04122                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
masw  Massilia sp. WG5
Pathway
masw00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:masw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AM586_24155
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:masw02000]
    AM586_24155
Enzymes [BR:masw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AM586_24155
Transporters [BR:masw02000]
 Other Transporters
  Pores ion channels [TC:1]
   AM586_24155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_C_2 GST_C_3 GST_N_2 GST_N_3 CtsR
Motif
Other DBs
NCBI-ProteinID: ALK98829
LinkDB All DBs
Position
complement(2597562..2598170)
Genome map
AA seq 202 aa AA seqDB search
MKLYFSPGACSLSPHIALLEAGLEFTTEKVDIRARQTASGADFLKINPKGYVPALELNDG
AVLTEGPAIVQFIADLAPDRQLAPVNGTLERYRLVEWLNFISTEVHKNFSPLFRPTSTEE
MKEAARANLSNRLGWVASQLEGRDYLMGSQFTVADGYLFTVLGWANFVQFDLAQWPVFAA
YTQRIAARPAVQQALRAEGLLK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtatttcagccccggcgcctgctcgctctctcctcatatcgccctgctcgag
gcaggcctggagttcaccaccgagaaagtggacatccgcgccaggcagaccgccagcggc
gccgatttcctgaagatcaacccgaagggctatgtgccggcgctcgagctgaacgacggc
gccgtgctgaccgaaggcccggccatcgtccagttcatcgccgacctggccccggatcgc
cagctggcgccggtcaacggcaccctggaacgctatcgcctggtcgaatggctgaacttc
atctcgaccgaggtgcacaagaacttcagcccgctgttccgccccacctcgaccgaggaa
atgaaggaagcggcgcgcgccaacctgagcaaccgcctgggctgggtggccagccagctg
gaaggccgcgattacctgatgggttcgcagttcacggtggccgacggctacctgttcacg
gtgctgggctgggccaacttcgtccagtttgatctggcgcaatggccggtgttcgccgcc
tacacccagcgcatcgcggcccgtccggccgtgcagcaggcgctgcgcgccgaaggcctg
ctcaagtaa

DBGET integrated database retrieval system