KEGG   Massilia sp. YMA4: DPH57_10745Help
Entry
DPH57_10745       CDS       T05528                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
masy  Massilia sp. YMA4
Pathway
masy00620  Pyruvate metabolism
masy00680  Methane metabolism
masy01100  Metabolic pathways
masy01120  Microbial metabolism in diverse environments
masy01200  Carbon metabolism
Module
masy_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:masy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DPH57_10745
  09102 Energy metabolism
   00680 Methane metabolism
    DPH57_10745
Enzymes [BR:masy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DPH57_10745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AXA91584
UniProt: A0A344JES5
LinkDB All DBs
Position
2538672..2541524
Genome map
AA seq 950 aa AA seqDB search
MVNFASATDEQLREPTIEQSNTPADDKDAPLKEDIRLLGRLLGDVLREQEGEEVFAVVET
IRQTAVRFRREADAGAAKELDGMLKILTREQTITVVRAFSYFSHLANIAEDQHHIRRRRA
HLLAGSKAQRGSIGYALAKLKDAGVDKETVDGFFHDALISPVLTAHPTEVQRKSILDAEH
DIARLLAERDLPLTPRERAANLHMLRVRIATLWQTRMLRYTKLTVADEIENALSYYRITF
LREVPGLYDDIEEDIAAQYGHEKPSQIPAPYLQMGSWIGGDRDGNPNVNAGTMQHALARH
ATTIIDFYLDEAHALGADLSVSTLMVGCSPALQALADASPDQSDHRADEPYRRALIGIYA
RLASTARALGAANILRKEVGHAEPYADAAAFSADLQVLIDSLDANHGGMLARPRLTTLKR
AADVFGFHLASLDMRQSSDVHERVLAELFARAGGEPDYAGLDEEAKVKLLLAELAQPRLL
YSPYIDYTPETQSELSIFRAAREIRQRYGARAIRNYIISHTETVSDLLEVLVLQQETGLL
RQDADGNATADLMVIPLFETIPDLQRAAGIMAEVMALPLVQQLIERQGRIQEVMLGYSDS
NKDGGFLTSNWELYKAEIALIDVFGKAGVKLRLFHGRGGTVGRGGGPSYEAILAQPKGTV
NGQIRLTEQGEIIASKFSNAEIGRRNLELLVAATLEASLLPPPAEAAQKEQLAGFEGVMA
EISNLAYKAYRNLVYETPGFTDYFFAATPIAEIAELNLGSRPASRKSTKRIEDLRAIPWG
FSWGQCRLLLPGWFGFGSAIGQWIDGGDRAERIAQLRDMHAHWPFFATLLSNMDMVLAKT
DLAIASRYAELVADEELRERIFRRICEEYRHTLECLETITGTSERLVGNPLLARSITNRF
AYLDPLNHLQVELIKRHRALSAQPDKADPRVHRGIHLSINGVAAGLRNTG
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atggtaaattttgctagtgcgacagacgaacaactccgcgaaccgacgatcgagcaaagc
aacaccccggccgacgacaaggacgcgccgctgaaggaagacatccgcctgctgggccgc
ctgctgggcgacgtgctgcgcgaacaggaaggcgaggaagtgttcgccgtggtcgagacg
atccgccagaccgccgtgcgcttccgccgcgaggccgacgcgggcgccgccaaggaactg
gacggcatgctgaagatcctgacgcgcgagcagacgatcaccgtcgtgcgcgcgttctcc
tacttctcgcacctggccaatatcgccgaggaccagcaccacatccgccgccgccgtgcc
cacctgctggccggctcaaaggcgcagcgcggcagcatcggctacgcgctggccaagctg
aaggacgccggggtggacaaggaaaccgtggacggcttcttccacgacgcgctgatctcc
ccggtgctgacggcccacccgaccgaagtgcagcgcaaatcgatcctggacgcggagcac
gacatcgcccgcctgctggccgagcgcgacctgccgctgacgccgcgcgagcgcgccgcc
aacctgcacatgctgcgcgtgcgcatcgccaccctgtggcagacgcgcatgctgcgctac
accaagctgaccgtggccgacgagatcgagaacgcgctgtcctactaccgcatcacgttc
ctgcgcgaggtgccgggcctgtacgacgacatcgaggaagacatcgccgcccagtacggc
catgagaaaccgtcgcagatcccggcgccctacctgcagatgggcagctggatcggcggc
gaccgcgacggcaacccgaacgtcaacgccggcaccatgcagcacgcgctggcgcgccac
gccaccacgatcatcgacttctacctggacgaagcgcacgccctgggcgccgacctgtcg
gtctcgacgctgatggtcggctgcagcccggcgctgcaggcactggccgacgcctcgccg
gaccagtccgaccaccgcgccgacgagccgtaccgccgcgccctgatcggcatctacgcg
cgcctggcgtccaccgcacgcgcgctgggcgccgccaacatcctgcgcaaggaagtgggc
cacgccgagccgtacgccgacgcggccgcgttctcggccgacctgcaggtgctgatcgac
tcgctcgatgccaaccacggcggcatgctggcgcgtccgcgcctgaccaccctgaaacgc
gcggccgacgtgttcgggttccacctggcctcgctggacatgcgccagtcgtccgacgtg
cacgagcgcgtgctggccgagctgttcgcgcgcgccggcggcgagcccgattacgccggc
ctggacgaggaagccaaggtcaagctgctgctggccgagctggcgcaaccacggctgctg
tattcgccgtacatcgactacacgccggagacgcaatcggaactgtcgatcttccgcgcc
gcccgcgagatccgccagcgctacggcgcgcgcgcgatccgcaactacatcatctcgcac
acggaaaccgtgtcggacctgctggaagtactggtgctgcagcaggagaccggcctgctg
cgccaggacgccgacggcaacgcgaccgccgacctgatggtgatcccgctgttcgagacg
attcccgacctgcagcgcgcggccggcatcatggccgaggtgatggcactgccgctggtg
cagcagctgatcgaacgccagggccgcatccaggaagtcatgctgggctactcggactcg
aacaaggacggcggtttcctgacctcgaactgggagctgtacaaggccgagatcgcgctg
atcgacgtgttcggcaaggccggcgtcaagctgcgcctgttccacggccgtggcggcacg
gtgggccgcggcggcggtccaagctacgaggccatcctggcgcagccgaaaggcaccgtc
aacggccagatccggctgaccgagcagggcgagatcatcgcgtcgaaattctccaacgcg
gagatcggccggcgcaacctggagctgctggtcgcggccacccttgaggcgagcctgctg
ccgccgcccgccgaggcggcgcagaaggaacaactggccggcttcgagggcgtgatggcg
gagatctcgaacctggcgtacaaggcctaccgcaatctcgtctacgagacgcccggcttc
acggactacttcttcgccgccacgccgatcgccgagatcgcggaactgaacctgggttcg
cgcccggcctcgcgcaagtcgaccaagcgcatcgaagacctgcgcgcgattccatggggc
ttctcgtggggccagtgccgcctgctgctgccgggctggttcggcttcggcagcgccatc
ggccagtggatcgacggtggcgaccgcgccgagcgcatcgcccagctgcgcgacatgcac
gcgcactggccattcttcgccacgctgctgtcgaatatggacatggtgctggcgaaaacc
gacctggccatcgcctcgcgctacgccgagctggtggcggacgaggaactgcgcgagcgc
atcttccgccgcatctgcgaggaataccgccacacgctggaatgcctggagacgatcacc
ggcacgtccgagcgcctggtcggcaatccgctgctggcccggtcgatcaccaaccgcttc
gcctacctggacccgctgaaccacttgcaggtcgagctgatcaagcgccaccgcgcgctg
tcggcgcagccggacaaggcggacccgcgcgtgcatcgggggattcacctgtcgatcaat
ggggtggcggcggggttgcgcaataccggctga

DBGET integrated database retrieval system