KEGG   Massilia sp. YMA4: DPH57_12455Help
Entry
DPH57_12455       CDS       T05528                                 

Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
masy  Massilia sp. YMA4
Brite
Enzymes [BR:masy01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DPH57_12455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AXA91884
UniProt: A0A344JFM5
LinkDB All DBs
Position
2923349..2923927
Genome map
AA seq 192 aa AA seqDB search
MEHTLPPLPYAMDALQPHISKETLEYHYGKHHQAYVTNLNNLIKGTEFENMSLEEIIKKS
SGGVFNNSAQVWNHTFYWNCMAPNAGGAATGAVADAINAKWGSFDKFKEEFSKSCVGNFG
SGWTWLVKKADGTVDIVNTSNAQTPLTTADKPLLTCDVWEHAYYVDYRNARPKYVETFWN
LVNWNFVNEQFA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggaacataccctgccgccactgccgtatgcgatggatgccctgcagccgcacatctcc
aaggaaaccctggaataccactacggcaagcaccaccaggcctatgtaacgaacctgaac
aacctgatcaagggtaccgagttcgagaacatgtccctcgaagagatcatcaagaaatcg
tccggtggcgtcttcaacaactccgcccaggtgtggaaccacacgttctactggaactgc
atggccccgaacgcgggcggcgcggccaccggcgccgtggcggacgcgatcaacgccaaa
tggggttcgttcgacaagttcaaggaagagttcagcaagtcctgcgtgggcaacttcggc
tccggctggacctggctggtgaagaaggccgacggcaccgtcgacatcgtcaacacctcc
aatgcgcagaccccgctgacgacggccgacaagccgctgctgacctgcgacgtgtgggaa
cacgcttactatgtcgactaccgcaacgcccgtccgaaatacgtcgagacgttctggaac
ctggtcaactggaacttcgtgaacgaacagttcgcctga

DBGET integrated database retrieval system