KEGG   Massilia sp. YMA4: DPH57_18345Help
Entry
DPH57_18345       CDS       T05528                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
masy  Massilia sp. YMA4
Pathway
masy00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:masy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DPH57_18345
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:masy02000]
    DPH57_18345
Enzymes [BR:masy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     DPH57_18345
Transporters [BR:masy02000]
 Other Transporters
  Pores ion channels [TC:1]
   DPH57_18345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_C_3 GST_N_2 GST_C_2 DSX_dimer
Motif
Other DBs
NCBI-ProteinID: AXA92936
UniProt: A0A344JIM7
LinkDB All DBs
Position
complement(4280941..4281624)
Genome map
AA seq 227 aa AA seqDB search
MIVVHHLNNSRSQRVLWLLEELGLPYEVVRYQRDAKTMLAPPALRAVHPLGKSPVIVDGD
CTVAESGAIIEYLLDKYDGQDGRAPLVPPRGTPEKRRWTYFLHYAEGSMMAPLLMKLIFD
RVENGPAPFFVKPIARGIAQKVKGSYIEPQINQHLAYLEKELGQHQWFAGDSFSAADIQM
SFPLEAAAARGGLDTRFPKLKAFLDRIHARPAYQRALEQGGPYELLR
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtcgtccatcacctgaacaactcccgctcgcagcgcgtcctgtggctgctggaa
gagctgggcctgccttacgaggtcgtgcggtaccagcgcgacgcgaaaacgatgctggcg
ccgcccgcgctgcgcgcggtgcacccgctgggcaagtcgcccgtgatcgtggacggcgac
tgcaccgtggcggaatccggcgcgatcatcgaatacttgctggacaagtacgacggccag
gatggccgcgcgccactggtgccgccacgtggcacgccggaaaagcgccgctggacgtat
ttcctgcattacgcggaaggctcgatgatggcgccgctgctgatgaagctgattttcgac
cgggtcgagaatggcccggcgccgttcttcgtcaagccgatcgcacgcggtatcgcgcag
aaggtcaagggcagctatatcgaaccgcagatcaaccagcacctggcctacctggaaaag
gaactgggccagcaccagtggtttgccggcgacagtttcagcgcggccgatatccagatg
agcttcccgctggaggcagccgccgcccgtggcgggctcgatacgcgcttcccgaaactg
aaggccttcctcgaccgcatccacgcgcggcctgcctaccagcgcgcgctggagcagggc
ggcccctacgagttgcttcgatga

DBGET integrated database retrieval system