KEGG   Massilia sp. YMA4: DPH57_20015Help
Entry
DPH57_20015       CDS       T05528                                 

Definition
(GenBank) sulfite exporter TauE/SafE family protein
  KO
K07090  uncharacterized protein
Organism
masy  Massilia sp. YMA4
Brite
KEGG Orthology (KO) [BR:masy00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    DPH57_20015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AXA93229
UniProt: A0A344JJH0
LinkDB All DBs
Position
complement(4660424..4661188)
Genome map
AA seq 254 aa AA seqDB search
MLDYAMLGVAAFAAGLVDAVVGGGGLIQIPVLFSVFGNTAPATLLGTSKLAGIFGTAAAA
VNYARRVSIAWSTAAPAAVAAFLFAFCGAYTVTHIPADFMRTLLPIVLLAVAVYTFRRKD
FGSVHAPLHTGRREQVFAVLSGAGIGFYDGFFGPGTGSFLVFLFVRVFGFDFLGASAVAK
VVNVACNLSALMWFGYSGHLLWQLGLMMAVCQVAGSLIGTKLAMRHGSGFVRRVFLVVVS
VLIVKTGWDAWQRW
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgctcgattacgcgatgttgggagtggcggcgttcgccgccggcttggtggatgcggtg
gtggggggaggcggattgatccagattcccgtgctgttctccgtgttcggcaacacggcg
cccgccacgctgctgggtaccagcaagctggccggcatcttcggtactgcggccgccgcg
gtgaactacgcccgacgcgtgtcgatcgcctggtcgacggcggcaccggccgcagtggcg
gccttcctgttcgccttttgcggcgcctacaccgtgacgcacatcccggccgacttcatg
cgcaccttgctgcccatcgtgctgctggctgtggccgtctacacgttccgccgcaaggat
ttcggcagcgtgcacgcgccgctgcataccgggcggcgcgagcaggtgtttgccgtgttg
agcggcgccggtatcggcttctatgacggcttcttcggtcccggcaccggcagcttcctg
gtgttcctgttcgtgcgcgtgttcggcttcgacttcctcggtgcgtcggccgtggcgaag
gtggtgaatgtggcgtgcaacctgtcggcgctgatgtggttcggatacagcggtcatctg
ttgtggcagctggggctgatgatggccgtgtgtcaggtggcggggtcgctgatcggcacg
aagctggcgatgcgtcacggcagcggtttcgtgcgccgcgtgttcctggtggtggtctcg
gtcctgatcgtcaagacgggctgggatgcttggcagcggtggtga

DBGET integrated database retrieval system