KEGG   Massilia sp. YMA4: DPH57_21185Help
Entry
DPH57_21185       CDS       T05528                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
masy  Massilia sp. YMA4
Brite
KEGG Orthology (KO) [BR:masy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DPH57_21185
Enzymes [BR:masy01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DPH57_21185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 DAO HI0933_like FAD_oxidored FAD_binding_3 Glutaredoxin Thi4 K_oxygenase NAD_binding_8 Thioredoxin_9 FMO-like
Motif
Other DBs
NCBI-ProteinID: AXA93443
LinkDB All DBs
Position
4924751..4926343
Genome map
AA seq 530 aa AA seqDB search
MLDANLKTQLKAYLEKVVQPIEIVASLDDSAKAREMQELLADIAGLSDKITVIEDNAANV
RKPSFSINRAGSDIGVRFAGIPMGHEFTSLVLALLQVGGHTIKLDEATIEQIRNLDGDYE
FETFISLSCHNCPEVVQALNAMSVINPRIKVTTIDGGVFQKEVEDRQIMAVPMMFLNGEH
FGQGRTNVEEILAKLDTNAGARQAAELNKKDVFDVLIVGGGPAGAASAIYAARKGINTGV
LAERFGGQVLDTLAIENFVSVKETDGPKFAVALEQHVKEYEVDVMNTQRAVKLVPGRIAE
VHTATGAVLKAKTVILSTGARWREINVPGEKEYRNHGVAYCPHCDGPLFKGKRVSVIGGG
NSGVEAAIDLAGIVQHVTLIEFGAELRADAVLQRKLRSLPNVTVILSAQTTEIHGDGKKV
NGLSYKDRNTNELHRVELEGVFVQIGLVPNTEWLKGTVALSKHGEIEIDAKGQTSVPGVF
AAGDVTTVPYKQIVIAVGAGATAALSAFDHLIRSGDDEVEAEQEKLATAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgctggatgcaaatctcaaaacccaactgaaagcctatctggaaaaagtggtgcagccg
attgagatcgtcgcatcgctggatgactccgccaaagcgcgggaaatgcaggaactgctc
gccgatatcgccggcttgagcgacaagattaccgttatcgaggacaacgccgccaacgtg
cgcaagccgtcgttctcgatcaaccgtgccggcagcgacattggcgtgcgctttgccggc
atcccgatgggccatgaattcacctccctggtgctggccctgctgcaggtgggcggccac
acgatcaagctggacgaagcgacgatcgaacagatccgcaacctggacggcgactacgaa
ttcgagaccttcatctcgctgtcgtgccataactgcccggaagtggtgcaggcactgaac
gcgatgtcggtcatcaacccacgcatcaaggtgacgacgatcgacggcggcgtgttccag
aaggaagtcgaggaccgccagatcatggccgtgccgatgatgttcctgaacggtgagcat
ttcggccagggccgcaccaacgtggaagaaatcctggccaagctggacaccaatgccggt
gcccgccaggccgccgaactgaacaagaaggacgtgttcgacgtgctgatcgtcggcggt
ggtcctgccggtgcggcgtcggcgatctacgccgcccgcaagggcatcaacaccggcgtg
ctggccgagcgtttcggcggccaggtgctggacacgctggcgatcgagaacttcgtctcc
gtcaaggaaacggatggcccgaaattcgccgtcgccctggagcagcacgtcaaggaatac
gaagtggacgtgatgaacacccagcgcgccgtcaagctggtgccgggccgcatcgccgaa
gtgcacaccgccaccggcgccgtgctgaaggccaagaccgtgatcctgtcgacgggtgcg
cgctggcgcgagatcaacgtgccgggcgagaaggaataccgcaaccacggcgtggcgtac
tgcccgcactgcgacggcccgctgttcaagggcaagcgcgtatcggtgatcggcggcggc
aactccggtgtggaagcggcgatcgacttggccggtatcgtccagcacgtcaccctgatc
gagttcggcgcggaactgcgggcggacgcggtgttgcagcgcaagctgcgctcgctgccg
aacgtcaccgtgatcctgtcggcgcagaccacggaaatccatggcgacggcaagaaggtc
aacggcctgtcgtacaaggaccgcaacacgaacgagctgcaccgcgtggaactggaaggc
gtgttcgtgcagatcggcctggtgccgaacacggaatggctgaagggcaccgtggcgctg
tccaagcacggcgagatcgagatcgatgccaagggccagacgtcggtaccgggcgtgttc
gccgccggcgacgtgacgacggtaccgtacaagcagatcgtcatcgccgtgggcgccggc
gcgacggcggcactgtccgccttcgaccacctgatccgctcgggcgacgacgaagtggaa
gccgagcaggaaaagctcgccaccgcggcgtaa

DBGET integrated database retrieval system