KEGG   Massilia armeniaca: C9I28_00640Help
Entry
C9I28_00640       CDS       T05378                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
masz  Massilia armeniaca
Brite
KEGG Orthology (KO) [BR:masz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C9I28_00640
Enzymes [BR:masz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C9I28_00640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 DAO FAD_binding_2 Glutaredoxin HI0933_like FAD_oxidored FAD_binding_3 Thi4 K_oxygenase FMO-like Thioredoxin_9 NAD_binding_8 YojJ AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AVR94378
UniProt: A0A2R4C495
LinkDB All DBs
Position
complement(140528..142120)
Genome map
AA seq 530 aa AA seqDB search
MLDANLKTQLKAYLEKVVQPIEIVASLDDSAKAREMQELLADIEGLSDKITVIEDNAANV
RKPSFSINRAGSDIGVRFAGIPMGHEFTSLVLALLQVGGHTIKLDEATIEQIRNLDGDYE
FETFISLSCHNCPEVVQALNAMSVINPRIKVTTIDGGVFQKEVEDRQIMAVPMMFLNGEH
FGQGRTNVEEILAKLDTNAGARQAAELNKKDVFDVLIVGGGPAGAASAIYAARKGINTGV
LAERFGGQVLDTLAIENFVSIKETDGPKFAVALEQHVKEYEVDIINTQRAIKLVPGRIAE
VHTATGAVLKAKTVILSTGARWREINVPGEKEYRNHGVAYCPHCDGPLFKGKRVAVIGGG
NSGVEAAIDLAGIVQHVTLIEFGAELRADAVLQRKLRSLPNVTVILSAQTTEIHGDGKKV
NGLSYKDRNTNELHRVELEGVFVQIGLVPNTEWLKGTVALSKHGEIEIDAKGQTSVPGVF
AAGDVTTVPYKQIVIAVGAGATAALSAFDHLIRSGDDEVEAEQEKIATAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgctggatgcaaatctcaaaacccaactgaaagcctatctggaaaaagtggtgcagccg
attgagatcgtcgcatcgctggatgactccgccaaagcgcgggaaatgcaggaactgctc
gccgatatcgaaggcttgagcgacaagattaccgtgatcgaggacaacgccgccaacgtg
cgcaagccgtcgttctcgatcaaccgtgccggcagcgacatcggcgtgcgttttgccggc
atcccgatgggccatgagttcacctcgctggtgctggccctgctgcaggtgggcggccac
acgatcaagctggacgaagcgacgatcgaacagatccgcaacctggacggcgattacgaa
ttcgagaccttcatctcgctgtcgtgccataactgcccggaagtggtgcaggcactgaac
gcgatgtcggtgattaacccacgcatcaaggtgacgacgatcgatggcggtgtgttccag
aaggaagtcgaggaccgccagatcatggccgtgccgatgatgttcctgaacggcgaacac
ttcggccagggccgcaccaacgtggaagaaatcctggccaagctggacaccaatgccggt
gcccgccaggcagccgaactgaacaagaaagacgtgttcgacgtgctgatcgtcggcggc
ggtccagccggcgcggcgtcggcgatctacgccgcccgcaagggtatcaacaccggcgtg
ctggccgagcgtttcggcggccaggtgctggacaccttggcgatcgagaacttcgtctcc
atcaaggaaaccgacggcccgaaattcgccgtcgccctggagcagcacgtcaaggaatac
gaagtcgacatcattaacacccagcgcgccattaagctggtgccgggccgcatcgccgaa
gtccacaccgccaccggtgccgtgctgaaggcgaagaccgtgatcctgtcgacgggtgcc
cgctggcgcgagatcaacgtgccgggcgagaaggaataccgcaaccacggcgtggcgtac
tgcccgcactgcgatggcccgctgttcaagggcaagcgcgtggccgtgatcggcggcggc
aactccggcgtggaagcggcgatcgacctggccggcatcgtccagcacgtcaccttgatc
gagttcggtgcggaactgcgggcggacgccgtgctgcagcgcaagctgcgctcgctgccg
aacgtcaccgtgatcctgtcggcgcagacgaccgagatccatggcgacggcaagaaggtc
aacggcctgtcgtacaaggaccgcaacaccaatgaactgcaccgcgtggagctggaaggc
gtgttcgtgcagatcggcctggtgccgaacacggagtggctgaagggcaccgtggcgctg
tccaagcatggcgagatcgagatcgatgccaagggccagacgtcggtgccgggcgtgttt
gccgccggcgacgtgacgacggtgccgtacaagcagatcgtcatcgcggtcggcgccggc
gcgacggcggcactgtccgccttcgaccacctgatccgctcgggtgacgacgaggtggaa
gccgagcaggaaaaaatcgccaccgcggcgtaa

DBGET integrated database retrieval system