KEGG   Massilia armeniaca: C9I28_02315Help
Entry
C9I28_02315       CDS       T05378                                 

Definition
(GenBank) 2-nitropropane dioxygenase
  KO
K00459  nitronate monooxygenase [EC:1.13.12.16]
Organism
masz  Massilia armeniaca
Pathway
masz00910  Nitrogen metabolism
masz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:masz00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    C9I28_02315
Enzymes [BR:masz01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.12  With incorporation of one atom of oxygen (internal monooxygenases or internal mixed-function oxidases)
    1.13.12.16  nitronate monooxygenase
     C9I28_02315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NMO IMPDH FMN_dh DUF561 His_biosynth DHO_dh Dus Glu_synthase PEP_hydrolase G3P_antiterm ThiG NanE
Motif
Other DBs
NCBI-ProteinID: AVR94680
UniProt: A0A2R4C530
LinkDB All DBs
Position
complement(507395..508480)
Genome map
AA seq 361 aa AA seqDB search
MWKHTEVTRRLGLTVPIVQGPFGGGISSVDLVVAVCESGGLGSFGVHHLDGNGIREVAAA
IRARTARPFALNLWVPLDDSDDPRLDDEVFARNAALLEPYFTELGLAPPQRPQRFAPPYA
AQIEAVLAARPAVLSFVFGIPAPAILQRCRELDIVTVGAATTVAEAVALEQAGVDMIVAT
GFEAGGHRVAFLRAPEASLSGTFALVPQVADAVRIPVIAAGGIADGRGIAAALALGAQAV
QIGTAFLACRESNANPAHRAMLFSDEARETALTRVFSGRLARGIRNRLMAELEPHAAQLP
PYPVQNWFTSAIKKAAGTQERADLMSLWCGQAAPLLTQRDARSLMATLVEDTSRITRQLG
G
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaacatacggaagtaacgcgccgccttggcctgacggtccccatcgtccagggg
ccgttcggcggcggcatctcatcggtcgacctggtcgtggcggtgtgcgaaagcggcggt
ctcggttcctttggcgtgcaccacctggacggtaatgggattcgcgaggttgccgccgcg
atccgggcacgcaccgcgcgtccgttcgcgctgaacctgtgggtgccgttggacgacagc
gacgacccgcggctcgacgatgaagtgttcgcgcgcaacgcggcgttattagagccgtat
ttcaccgaactgggcctggcaccgccgcagcggccgcagcgcttcgccccgccctatgcc
gcgcagatcgaggccgtgctggcggcgcggccggcggtactcagcttcgtgttcggcatt
ccggcaccggcgatcctgcagcgctgccgcgagctggacatcgtgacggtgggcgccgcc
acgactgtcgcggaagccgtcgccctggagcaggccggcgtggatatgatcgtcgccacc
ggcttcgaggccggcggccatcgggtggcgttcctgcgcgcgccggaagcttcgctatcg
ggcaccttcgcactggtgccgcaggtggccgatgccgtgcgcattcccgtgatcgccgcc
ggcggcatcgcggacggccgcggcatcgccgccgcgctggcgctgggcgcccaggccgtg
cagatcggcacggcgttcctggcctgccgcgagtcgaacgccaacccagcccatcgcgcc
atgctgttcagcgacgaggcccgcgagacggcgttgacgcgcgtcttcagcggccggctg
gcacgcggcatccgcaaccgcctgatggccgagctggaaccgcacgccgcgcagctgccg
ccctaccccgtgcagaactggttcaccagcgccatcaagaaggccgcgggcacgcaagag
cgggccgacctgatgtcgctgtggtgcggccaggccgcgccgctgctgacccagcgcgac
gcgcgctccctgatggccacgctggtcgaggatacgtcgcggatcacccgccagctgggc
ggctga

DBGET integrated database retrieval system