KEGG   Massilia armeniaca: C9I28_02325Help
Entry
C9I28_02325       CDS       T05378                                 

Definition
(GenBank) LysR family transcriptional regulator
Organism
masz  Massilia armeniaca
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 MarR_2 HTH_AsnC-type HTH_28 P22_Cro HTH_IclR
Motif
Other DBs
NCBI-ProteinID: AVR94682
UniProt: A0A2R4C545
LinkDB All DBs
Position
509236..510162
Genome map
AA seq 308 aa AA seqDB search
MQRHFDDVLVGSIELFCAAAEQGSFTAAARALGVTPAAVSRSVARLEGRLGARLFVRTTR
QVSLTEVGRLYFEQCRQGLAQLIDAERAVTGAQGMPAGVVRISVPTTYGHHRVLPLLPRF
CARYPKVRVEIHVSNRNIDFVDEGYDLAIRARDLPDSRLVAHKLEDAELVVVAAPGYLAA
RGRPESIAALARHDCIGFALPSTNRPVPWLLRDGGATVEVAVAGACCVYEDLMAGVTLAR
SGAGLFQAYRFTVEQDLRAGTLVEVLHEHGGCSRPFSVLYPHGRHLALKVRAFLEFLRET
VAEVDPAL
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgccattttgacgatgtgctggtcggcagcatcgagctgttctgtgccgcggcc
gagcaaggcagctttacggcggccgcccgcgcgctcggggtgacgcccgccgccgtcagc
cggtcggtcgcgcggctggagggccggctgggagcgcggctgttcgtacgcaccacgcgc
caggtcagcctgacggaagtgggccgcctgtatttcgaacaatgtcgccagggactggcg
cagctgatcgatgcggagcgtgcggtgacgggcgcgcaggggatgccggccggcgtggtg
cgcatcagcgtgccgaccacctacggccaccatcgcgtgctgccgctgttgccgcgtttt
tgcgcgcgctatccgaaggtgcgcgtggagatccacgtcagcaaccgcaatatcgatttc
gtcgacgaaggctacgacctggcgatccgcgcacgcgacctgcccgattcccgcctggtc
gcacacaagctggaagacgccgaactggtcgtcgtggcggcgcccggctacctggccgca
cgcggccggcccgagtcgatcgcggcgctggcgcggcacgactgcatcggcttcgccctg
cccagtaccaaccgccccgtgccctggctgctgcgcgacggtggcgcgaccgtcgaggtg
gctgtagcgggcgcctgctgcgtgtacgaagacctgatggccggggtgacgctggcgcgc
agcggcgccggcctgttccaggcctaccggtttacggtcgagcaagacttgcgcgccggc
acgctggtcgaagtgctgcatgagcacggcggctgctcgcggccgttttccgtgctgtac
ccgcacggccggcacctggctctgaaagtacgggccttcctggaattcctgcgcgagacg
gtggccgaggttgacccggccttgtga

DBGET integrated database retrieval system