KEGG   Massilia armeniaca: C9I28_03580Help
Entry
C9I28_03580       CDS       T05378                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
masz  Massilia armeniaca
Pathway
masz00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:masz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C9I28_03580
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:masz02000]
    C9I28_03580
Enzymes [BR:masz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     C9I28_03580
Transporters [BR:masz02000]
 Other Transporters
  Pores ion channels [TC:1]
   C9I28_03580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_3 GST_C_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AVR94895
UniProt: A0A2R4C5K9
LinkDB All DBs
Position
808369..809052
Genome map
AA seq 227 aa AA seqDB search
MIVVHHLNNSRSQRVLWLLEELGLPYEVVRYQRDAKTMLAPPALRAVHPLGKSPVIVDGD
CTVAESGAIIEYLIDKYDGQDGRTPLVPPRGTPEKRRWTYFLHYAEGSMMAPLLMKLIFD
RVENGPAPFFVKPIARGIAQKVKGSYIEPQINQHLAYLEAELGKHAWFAGDSFSAADIQM
SFPLEAAAARGGLDARFPKLKAFLERIHARPAYQRALEQGGPYELLR
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtcgtccaccacctgaacaactcccgctcgcagcgcgtgctgtggctgctggaa
gagctgggcctgccgtatgaagtcgtgcgctaccagcgcgacgcgaaaacgatgctggcg
ccgccagcgttgcgggccgtgcacccgctgggcaagtcgccagtgatcgtggacggcgac
tgcactgtcgcggaatcgggggcgatcatcgaatacctgatcgacaagtacgacggccag
gacggccgcacgccattggtgccgccgcgcggcacaccggaaaagcgccgctggacgtac
ttcctgcattacgcggaaggctcgatgatggcgccgctgctgatgaagctgatcttcgac
cgggtcgagaacggcccggcgccgttcttcgtcaagccgatcgcgcgcggcatcgcgcag
aaggtcaagggcagctacatcgaaccgcagatcaaccagcacctggcttatcttgaggcc
gagctgggcaagcacgcgtggtttgcgggcgacagtttcagcgccgccgacatccagatg
agcttcccgctggaggcggcggccgcgcgcggcgggctcgatgcgcgcttcccgaaactg
aaggcgttcctcgagcgcatccatgcgcgacctgcgtaccagcgcgcgctggagcagggc
ggcccctacgagttgcttcgttga

DBGET integrated database retrieval system