KEGG   Massilia armeniaca: C9I28_11280Help
Entry
C9I28_11280       CDS       T05378                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
masz  Massilia armeniaca
Pathway
masz00620  Pyruvate metabolism
masz00680  Methane metabolism
masz01100  Metabolic pathways
masz01120  Microbial metabolism in diverse environments
masz01200  Carbon metabolism
Module
masz_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:masz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C9I28_11280
  09102 Energy metabolism
   00680 Methane metabolism
    C9I28_11280
Enzymes [BR:masz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     C9I28_11280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AVR96226
UniProt: A0A2R4C9D2
LinkDB All DBs
Position
complement(2575532..2578384)
Genome map
AA seq 950 aa AA seqDB search
MVNFASATDEQLPASTIEQSGTPADDKDAPLKEDIRLLGRLLGDVLREQEGEEVFAVVET
IRQTAVRFRREADAGAAKELDGMLKILTREQTITVVRAFSYFSHLANIAEDQHHIRRRRA
HLLAGSKAQRGSIGYALAKLKDAGVDKETVDGFFHDALISPVLTAHPTEVQRKSILDAEH
DIARLLAERDLPLTPRERAANLHMLRVRIATLWQTRMLRYTKLTVADEIENALSYYRITF
LREVPGLYDDIEEDIAAQYGHEQPSQIPAPYLQMGSWIGGDRDGNPNVNAGTMQHALARH
ATTIIDFYLDEAHALGADLSVSTLMVGCSPELKALADASPDQSDHRADEPYRRALIGIYA
RLASTARALGAANILRKEVGHAEPYADAVAFSADLQVLIDSLDANHGGMLARPRLTTLKR
AADVFGFHLASLDMRQSSDVHERVLAELFARAGGEPDYAALDEAAKVQLLLAELAQPRLL
YSPYIDYTPETQSELSIFRAAREIRQRYGARAIRNYIISHTETVSDLLEVLVLQQETGLL
RQDADGNATADLMVIPLFETIPDLQRAAGIMAEVMALPLVQQLIERQGRIQEVMLGYSDS
NKDGGFLTSNWELYKAEIALIDVFAKAGVKLRLFHGRGGTVGRGGGPSYEAILAQPKGTV
NGQIRLTEQGEIIASKFSNAEIGRRNLELLVAATLEASLLPPPAEAAQKEQLAGFEAVMA
EISNLAYKAYRNLVYETPGFTDYFFAATPIAEIAELNLGSRPASRKSTKRIEDLRAIPWG
FSWGQCRLLLPGWFGFGSAIGQWIDGGDRSERIAQLRDMHAHWPFFATLLSNMDMVLAKT
DLAIASRYAELVADEELRERIFRRICEEYRHTLECLETITGTSERLVGNPLLARSITNRF
AYLDPLNHLQVELIKRHRALSAQPDKADPRVHRGIHLSINGVAAGLRNTG
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atggtaaattttgctagtgcgacagacgaacaactccctgcatcaacgatcgagcaatcg
ggcaccccggccgacgacaaggacgcgccgctgaaggaagacatccgcctgctgggccgc
ctgctgggcgacgtgctgcgcgaacaggaaggcgaggaagtgttcgccgtggtggagacg
atccgccagaccgccgtgcgcttccgccgcgaggccgatgccggcgccgccaaggaactg
gacggcatgctgaagatcctgacgcgcgagcagacgatcacggtcgtgcgcgcgttctcc
tacttctcgcacctggccaatatcgccgaggaccagcaccacatccgccgccgccgtgcc
cacctgctggccggctccaaggcgcagcgcggcagcatcggctacgccctggccaagctg
aaggacgccggcgtggacaaggaaacggtcgacggcttcttccacgacgcgctgatctcg
ccggtcctgacggcgcacccgaccgaggtgcagcgcaagtcgatcctggacgcggaacac
gacatcgcccgcctgctggccgagcgcgacctgccgctgacgccgcgcgagcgcgccgcc
aacctgcacatgctgcgcgtgcgcatcgccaccctgtggcagacgcgcatgctgcgctac
accaagctgacggtggccgacgagatcgagaacgcgctgtcgtactaccgcatcacgttc
ctgcgcgaggtgccgggcctgtacgacgacatcgaggaggacatcgccgcccagtacggc
cacgagcagccgtcgcagattcccgcgccctacctgcagatgggcagctggatcggcggc
gaccgtgacggcaatccgaacgtcaacgccggcacgatgcagcacgcactggcgcgccac
gccaccaccatcatcgacttctacctggacgaggcgcacgcgctgggcgcggacctgtcg
gtgtccacgctgatggtcggctgcagccccgagttgaaggcgctggccgacgcctcgccg
gaccagtccgaccaccgcgccgacgagccgtaccgccgcgcgctgatcggcatctatgcg
cgcctggcctccacggcgcgcgccctgggcgccgccaacatcctgcgcaaggaagtgggc
cacgccgagccgtatgccgacgcggtcgcgttctcggccgacctgcaggtgctgatcgac
tcgctggacgccaaccacggcggcatgctggcgcgcccgcgcctgaccaccctgaagcgc
gccgccgacgtgttcggcttccacctggcctcgctggacatgcgccagtcgtccgacgtg
cacgagcgggtgctggccgagctgttcgcccgcgccggcggcgagcccgattacgccgcc
ctggacgaagcagccaaggtccagctgctgctggccgagctggcgcaaccgcgcctgctg
tactcgccctatatcgactacacgccggagacgcagtcggagctgtcgatcttccgcgcc
gcgcgcgaaatccgccagcgctacggcgcgcgcgcgatccgcaactacatcatctcgcat
accgagacggtgtcggacctgctggaagtgctggtactgcagcaggagaccggcctgctg
cgccaggatgccgacggcaacgcgacggccgacctgatggtgatcccgctgttcgagacg
attcccgacctgcagcgcgccgccggcatcatggccgaggtgatggcgctgccgctggtg
cagcagctgatcgaacgccagggccgcatccaggaagtcatgctgggctattcggactcg
aacaaggacggcggtttcctgacgtcgaactgggagctgtacaaggccgagatcgcgctg
atcgacgtgttcgccaaggccggcgtcaagctgcgcctgttccacggccgcggcggcacg
gtgggccgcggcggcggtccaagctacgaagcgatcctggcgcagccgaagggcaccgtc
aacggccagatccgcctgaccgaacagggcgagatcatcgcgtcgaagttctccaacgcg
gagatcggccgccgcaacctggaactgctggtggccgcgaccctggaagcgagcctgctg
ccgccgccggcggaagcggcccagaaggagcagctggccggcttcgaggccgtgatggcg
gagatctcgaacctggcgtacaaggcctaccgcaacctggtctacgaaacgcccggcttc
acggactacttcttcgccgccacgccgatcgccgagatcgcggagctgaacctgggttcg
cgcccggcctcgcgcaagtcgaccaagcgcatcgaagacctgcgtgccattccgtggggc
ttctcgtggggccagtgccgcctgctgctgccgggctggttcggcttcggcagcgccatc
ggccagtggatcgatggcggcgaccgctccgagcgcatcgcccagctgcgcgacatgcac
gcgcactggccgttcttcgccacgctgctgtcgaacatggacatggtgctggcaaaaacc
gacctggccatcgcctcgcgctatgccgagctggtggcggacgaggaactgcgcgagcgc
atcttccgccgcatctgcgaggaataccgccacacgctggaatgcctggagacgatcacc
ggcacgtcggagcgcctggtcggcaatccgctgctggcacgctcgatcaccaaccgcttc
gcctacctggacccgctgaaccacttgcaggtggagctgatcaagcgccaccgcgcgctg
tcggcgcagccggacaaggcggacccgcgcgtgcatcgcggcattcacctgtcgatcaac
ggggtggcggctggtctgcgcaacaccggctga

DBGET integrated database retrieval system