KEGG   Massilia armeniaca: C9I28_23710Help
Entry
C9I28_23710       CDS       T05378                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
masz  Massilia armeniaca
Brite
KEGG Orthology (KO) [BR:masz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:masz01002]
    C9I28_23710
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:masz04147]
    C9I28_23710
   04090 CD molecules [BR:masz04090]
    C9I28_23710
Enzymes [BR:masz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     C9I28_23710
Peptidases [BR:masz01002]
 Metallo Peptidases
  Family M2
   C9I28_23710
Exosome [BR:masz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   C9I28_23710
CD molecules [BR:masz04090]
 Proteins
  C9I28_23710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2 Nrap_D4
Motif
Other DBs
NCBI-ProteinID: AVR99362
UniProt: A0A2R4CII8
LinkDB All DBs
Position
5438438..5440255
Genome map
AA seq 605 aa AA seqDB search
MALAVLLALTAGAAQAQAKPKAHGKPTVAEARRFLAETEQKFDKLNLDGARAEWVGSNFI
TDDTEAIAAYFGELQLDAAGQAALQARRYNGLKLNADEARKLKLLQLTLMLSDPKERAEY
AAARAALNGAYGKAKYCPPQGAPLASAGKDCLALGELEKVLANSREPAKLLDAWSGWHSQ
SPSYKQRYVDFVALSNKGAREMGFADTGALWRSQYDMAPDAFAAEMERLWQQVKPLYDSL
HTYTRYKLRAAYGPDVVPATGPIPAHLFGNMWSQTWDNIYPLLKPAGDTTGFDLTKVLEE
RKTSAKEMTQYAEGFYTSLGMQKLPASFWERSLLTKPRDRDVVCHASAWPIDGKDDVRIK
MCITPTAEDFTVIHHELGHIYYFLEYKDQPVLFRQGANDGFHEAIGDTVALSITPGYLKK
IGLMNQEPDPKGDIPELLKRALSKVAILPFAYSVDKWRWDVYGGKTQPADYDKTWWQLRE
QYMGVKRPAPALANGFDAGAKYHVAADVPYARYFLADLLQFQFHRALCREAGYTGPLHQC
SIYGNEKAGQKLRAMLQMGTSKPWPEELKAISGEDRIDGNALLEYFAPLKAWLDEQNRVL
AAQQK
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
ctggcactggccgtgctgctcgcgctgaccgcgggcgcagcgcaggcgcaggcaaaaccg
aaggcgcacggcaaacccaccgtcgccgaagcccggcgcttcctggcggagacggaacag
aagttcgacaagctcaatctcgacggcgcgcgcgccgaatgggtcggctccaatttcatc
acggacgatacggaagccatcgccgcctacttcggcgagctgcagctggacgccgccggc
caggccgccctgcaggcgcgccgctacaacggcctgaaactgaacgcggacgaggcgcgc
aagctgaaactgctccagctgacactgatgctgtccgatccgaaggaacgtgccgagtat
gctgccgcacgcgccgcgctgaacggcgcctacggcaaggccaaatattgtccaccgcag
ggcgcgccgctggccagcgccggcaaggactgcctggcgctgggcgaactggaaaaggtg
ctggccaacagccgcgaaccggccaagctgctggacgcgtggtcgggctggcacagccag
tcgccgtcgtacaagcagcgctacgtggatttcgtggcgctgtccaacaagggcgcgcgc
gagatgggcttcgccgacaccggcgcgctgtggcgctcgcagtacgacatggcgccggac
gccttcgccgccgagatggaacgcctgtggcagcaagtgaaaccgctgtacgactcgctg
cacacctacacccgctacaagctgcgcgccgcctacggcccggacgtggtgcctgccacc
ggcccgattccggcccacctgttcggcaatatgtggagccagacctgggacaacatctat
ccgctgctgaaacctgccggcgacaccaccggcttcgacctgacgaaggtgctggaagag
cgcaagacgtcggccaaggaaatgacgcagtacgcggaaggcttctacacctcgctgggc
atgcagaagctgccggcgtcgttctgggaacgctcgctgctgaccaagccgcgtgaccgc
gacgtggtctgccacgcctcggcctggccgatcgacggcaaggacgacgtgcgcatcaag
atgtgcatcacgccgacggcggaagacttcaccgtgatccaccatgagctgggccacatc
tattacttcctcgagtacaaggaccagccggtgctgttccgccagggcgccaacgacggc
ttccacgaggcgatcggcgacacggtggcgctgtccatcacgccaggctacctgaagaag
atcggcctgatgaaccaggagccggacccgaagggcgacattcccgagctgctcaagcgc
gcgctgtcgaaggtggcgatcctgccgttcgcctactccgtcgacaaatggcgctgggac
gtctacggcgggaagacccagccggccgactacgacaagacctggtggcagctgcgcgag
cagtacatgggcgtgaagcgcccggccccggcactggcgaacggcttcgacgccggcgcc
aagtaccacgtggccgccgacgtgccgtacgcgcgctacttcctggccgacctgctgcag
ttccagttccaccgcgcgctgtgccgcgaggccggctacacgggcccgctgcaccagtgc
tcgatctacggcaacgagaaggccggccagaagctgcgcgccatgctgcagatgggcacc
agcaagccgtggccggaagagctgaaggcgatcagcggcgaggaccggatcgacggtaac
gcgctgctggagtacttcgccccgctgaaggcctggctggacgagcagaatcgcgtgctg
gccgcgcagcagaagtaa

DBGET integrated database retrieval system