KEGG   Mycoplasma arthritidis: MARTH_orf717Help
Entry
MARTH_orf717      CDS       T00724                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mat  Mycoplasma arthritidis
Brite
KEGG Orthology (KO) [BR:mat00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mat01001]
    MARTH_orf717
Enzymes [BR:mat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     MARTH_orf717
Protein kinases [BR:mat01001]
 Serine/threonine kinases: Other
  Bacterial family
   MARTH_orf717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr RIO1 Kinase-like Kdo FTA2 APH Choline_kinase Pkinase_fungal AMA-1
Motif
Other DBs
NCBI-ProteinID: ACF07478
UniProt: B3PN76
LinkDB All DBs
Position
662193..663191
Genome map
AA seq 332 aa AA seqDB search
MAGAKENKNLTKHFKIIKQIGRGGFGTVFSAVHRASGKKFAVKVLTINGPRQQIVYKRFE
NEIKVIKRIKSKNVVRLFGHYITPKESYMAMELVEGTDLKTQISKKRKIPLEEAIEYAKE
ICNGLIDIHKENVVHRDLKPSNILITYDGTIKLIDFGISLGDDSLRLTDERKLIGSVQYV
SPELVLKQAEPSPQSDIYALGIVLYEMLTGKAPFTGSDHQTIALSHTKREIPRLEQVNVL
VPQAVENIIIKCTAKNPDDRYVSCVELYEDLSTCLSQKRANEPRLIIGKSSKKEAFIKKV
NSKAMTISLILIGAISIVIIIVLIVLHLKKII
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggccggtgcaaaagaaaataaaaatctaacgaaacacttcaaaattattaaacaaatt
ggtagaggtgggtttggcactgtattttctgccgttcatcgtgcaagcggtaaaaaattt
gcagtcaaagttttaacaattaatggtccacgtcagcaaattgtttacaagcgctttgaa
aacgaaatcaaggttattaaaagaataaaaagtaaaaatgtcgttagattatttgggcac
tatatcacccctaaagaaagctacatggcaatggagttagttgagggaactgacttaaaa
acgcaaattagtaaaaaacgcaaaattccattagaagaagctattgaatatgccaaagaa
atttgcaatggtcttattgatattcataaagaaaacgttgtgcatcgcgatctaaaacca
agtaatattctaatcacttatgatggcacaattaaactcattgattttggtatctcgtta
ggtgatgattctctaagattaaccgatgaaagaaaactaattggttcagtacaatatgta
tcaccagaattagtgctcaagcaagccgaaccttcacctcaaagtgatatctacgcctta
ggaatagtactttatgaaatgctaactggcaaggcaccttttactggctctgatcatcaa
accattgctcttagccacactaaaagagagattccgagactagaacaagttaatgtttta
gttccgcaagcggttgaaaatatcataataaaatgtaccgctaaaaatcctgatgatcgt
tatgttagttgcgttgaactttatgaagatttgagcacttgcttatcgcaaaaacgcgca
aacgagccacgtctaatcattggtaaatcttctaaaaaagaagcatttatcaaaaaagtg
aatagtaaagctatgacgatttcgcttattttgattggagcaatttcgatcgttattata
atagtgttgatcgttctccacctcaaaaaaatcatttaa

DBGET integrated database retrieval system